KEGG   Mus musculus (mouse): 18128Help
Entry
18128             CDS       T01002                                 

Gene name
Notch1, 9930111A19Rik, Mis6, N1, Tan1, lin-12
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05020  Prion diseases
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18128 (Notch1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    18128 (Notch1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18128 (Notch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18128 (Notch1)
   05206 MicroRNAs in cancer
    18128 (Notch1)
  09162 Cancer: specific types
   05224 Breast cancer
    18128 (Notch1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    18128 (Notch1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18128 (Notch1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18128 (Notch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch Ank_2 DUF3454 Ank NOD NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 18128
NCBI-ProteinID: NP_032740
MGI: 97363
Ensembl: ENSMUSG00000026923
Vega: OTTMUSG00000012795
UniProt: Q01705
LinkDB All DBs
Structure
PDB: 

Position
2 A3; 2 18.91 cM
AA seq 2531 aa AA seqDB search
MPRLLTPLLCLTLLPALAARGLRCSQPSGTCLNGGRCEVANGTEACVCSGAFVGQRCQDS
NPCLSTPCKNAGTCHVVDHGGTVDYACSCPLGFSGPLCLTPLDNACLANPCRNGGTCDLL
TLTEYKCRCPPGWSGKSCQQADPCASNPCANGGQCLPFESSYICRCPPGFHGPTCRQDVN
ECSQNPGLCRHGGTCHNEIGSYRCACRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDTT
HECACLPGFAGQNCEENVDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFQGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECALGA
NPCEHAGKCLNTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICMP
GYEGVYCEINTDECASSPCLHNGHCMDKINEFQCQCPKGFNGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECDPDPCHYGSCKDGVATFTCLCQPGYTGHHC
ETNINECHSQPCRHGGTCQDRDNSYLCLCLKGTTGPNCEINLDDCASNPCDSGTCLDKID
GYECACEPGYTGSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNEC
NSNPCIHGACRDGLNGYKCDCAPGWSGTNCDINNNECESNPCVNGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCPLPYTGATCEVVLAPCATSPCKN
SGVCKESEDYESFSCVCPTGWQGQTCEVDINECVKSPCRHGASCQNTNGSYRCLCQAGYT
GRNCESDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCQNGANC
TDCVDSYTCTCPVGFNGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQY
DVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSAPCKNGGRCWQTNTQ
YHCECRSGWTGVNCDVLSVSCEVAAQKRGIDVTLLCQHGGLCVDEGDKHYCHCQAGYTGS
YCEDEVDECSPNPCQNGATCTDYLGGFSCKCVAGYHGSNCSEEINECLSQPCQNGGTCID
LTNSYKCSCPRGTQGVHCEINVDDCHPPLDPASRSPKCFNNGTCVDQVGGYTCTCPPGFV
GERCEGDVNECLSNPCDPRGTQNCVQRVNDFHCECRAGHTGRRCESVINGCRGKPCKNGG
VCAVASNTARGFICRCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGSFTG
PECQFPASSPCVGSNPCYNQGTCEPTSENPFYRCLCPAKFNGLLCHILDYSFTGGAGRDI
PPPQIEEACELPECQVDAGNKVCNLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQLTEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVLVVLLPPDQLRNNSFHFLRELSHVLHTNVVFKRDAQGQQMIFPYY
GHEEELRKHPIKRSTVGWATSSLLPGTSGGRQRRELDPMDIRGSIVYLEIDNRQCVQSSS
QCFQSATDVAAFLGALASLGSLNIPYKIEAVKSEPVEPPLPSQLHLMYVAAAAFVLLFFV
GCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQ
NEWGDEDLETKKFRFEEPVVLPDLSDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDAD
CMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGET
ALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILLRNRATDLDA
RMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKN
GANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIV
RLLDEYNLVRSPQLHGTALGGTPTLSPTLCSPNGYLGNLKSATQGKKARKPSTKGLACGS
KEAKDLKARRKKSQDGKGCLLDSSSMLSPVDSLESPHGYLSDVASPPLLPSPFQQSPSMP
LSHLPGMPDTHLGISHLNVAAKPEMAALAGGSRLAFEPPPPRLSHLPVASSASTVLSTNG
TGAMNFTVGAPASLNGQCEWLPRLQNGMVPSQYNPLRPGVTPGTLSTQAAGLQHSMMGPL
HSSLSTNTLSPIIYQGLPNTRLATQPHLVQTQQVQPQNLQLQPQNLQPPSQPHLSVSSAA
NGHLGRSFLSGEPSQADVQPLGPSSLPVHTILPQESQALPTSLPSSMVPPMTTTQFLTPP
SQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTTMP
SQITHIPEAFK
NT seq 7596 nt NT seq  +upstreamnt  +downstreamnt
atgccacggctcctgacgcccttgctctgcctaacgctgctgcccgcgctcgccgcaaga
ggcttgagatgctcccagccaagtgggacctgcctgaatggagggaggtgcgaagtggcc
aacggcactgaagcctgtgtctgcagcggagcctttgtgggccaacgatgccaggactcc
aatccttgcctcagcacaccgtgtaagaatgctggaacgtgccacgttgtggaccatggt
ggcactgtggattatgcctgcagctgtcccctgggtttctctgggcccctctgcctgaca
cctctggacaacgcctgcctggccaacccctgccgcaatgggggcacctgtgacctgctc
actctcacagagtacaagtgccgctgcccaccagggtggtcaggaaaatcatgtcagcag
gctgacccctgtgcctccaacccctgtgccaatggtggccagtgcctgccctttgagtct
tcatacatctgtcgctgcccgcctggcttccatggccccacctgcaggcaagatgttaat
gagtgcagccagaaccctgggctgtgccgccatggaggcacctgccacaatgagatcggc
tcctatcgctgtgcctgccgtgccacccatactggtccccactgtgaactgccctatgtg
ccctgcagcccctcaccctgccagaatggaggcacctgccgtcctacaggggacaccacc
cacgagtgtgcctgcttgccaggttttgctggacagaactgtgaagaaaatgtggatgac
tgtccaggaaacaactgcaagaatgggggtgcctgtgtggacggcgtgaatacctacaat
tgccgctgcccaccggagtggacgggtcagtactgtacagaggatgtggacgaatgtcag
ctcatgcccaatgcctgccagaatggcggaacctgccacaacacacacggcggctacaac
tgtgtgtgtgtcaatgggtggactggcgaggactgcagtgagaacattgatgactgtgcc
agtgccgcctgtttccagggtgccacttgccacgaccgtgtggcttccttctactgcgaa
tgtccgcatgggcgcacaggtctgctgtgccacctcaacgatgcgtgcatcagcaacccc
tgcaacgagggctccaactgtgacaccaaccctgtcaacggcaaagccatctgcacctgc
ccctcggggtacacagggccagcctgcagccaggacgtggatgagtgtgctctgggtgcc
aacccttgtgagcacgcaggcaaatgcctcaacacactgggttcttttgagtgccagtgt
ctacagggctacacgggaccccgctgtgagattgatgttaatgagtgcatctccaaccca
tgtcagaatgatgccacttgcctggaccagattggggagttccaatgcatatgtatgcca
ggttatgaaggtgtatactgtgaaatcaacacggatgagtgcgccagcagcccctgtctg
cacaatggccactgcatggacaagatcaatgagttccaatgtcagtgccccaaaggcttc
aacgggcacctgtgccagtatgatgtggatgagtgtgccagcacaccatgcaagaacggt
gccaagtgcctggatgggcccaacacctatacctgcgtgtgtacagaaggttacacaggg
acccactgcgaagtggacattgacgagtgtgaccctgacccctgccactatggttcctgt
aaggatggtgtggccacctttacctgcctgtgccagccaggctacacaggccatcactgt
gagaccaacatcaatgagtgccacagccaaccgtgccgccatgggggcacctgccaggac
cgtgacaactcctacctctgcttatgcctcaagggaaccacagggcccaactgtgagatc
aacctggatgactgcgccagcaacccctgtgactctggcacctgtctggacaagattgat
ggctacgaatgtgcctgtgaaccaggctacacaggaagcatgtgtaacgtcaacattgac
gaatgtgcgggcagcccctgccacaacgggggcacttgtgaggatggcatcgcgggcttc
acttgccgctgccccgagggctaccatgaccccacgtgcctgtccgaggtcaacgagtgc
aacagtaacccctgcatccacggagcttgccgggatggcctcaatgggtacaagtgtgac
tgtgcccctgggtggagtggaacaaactgtgacatcaacaacaacgagtgtgagtccaac
ccttgtgtcaacggtggcacctgcaaggacatgaccagtggctacgtatgcacctgccga
gaaggcttcagtggccctaattgccagaccaacatcaacgaatgtgcctccaacccctgc
ctgaaccaggggacctgcattgatgatgtcgctggatacaagtgcaactgtcctctgcca
tatacaggagccacgtgtgaggtggtgttggccccatgtgctaccagcccctgcaaaaac
agcggggtatgcaaggagtctgaagactatgagagtttttcctgtgtctgtcccacaggc
tggcaaggtcaaacctgcgaggttgacatcaatgagtgtgtgaaaagcccatgtcgccat
ggggcctcctgccagaacaccaatggcagctaccgctgcctctgccaggccggctataca
ggtcgcaactgtgagagtgacatcgatgactgccgccccaacccgtgtcacaatgggggt
tcctgcaccgatggcatcaacacagccttctgcgactgcctgcccggcttccagggtgcc
ttctgtgaggaggacatcaatgaatgtgccagcaatccctgccaaaatggtgccaattgc
actgactgtgtggacagctacacatgtacctgccccgtgggcttcaatggcatccactgc
gagaacaacacacctgactgtactgagagctcctgcttcaatggtggtacctgtgtggat
ggtatcaactccttcacctgtctgtgtccacctggcttcacgggcagctactgtcagtat
gatgtcaatgagtgtgattcacggccctgtctgcacggtggtacctgccaagacagctat
ggtacttataagtgtacctgcccacagggctacactggtctcaactgccagaaccttgtg
cgctggtgcgactcggctccctgcaagaatggtggcaggtgctggcagaccaacacgcag
taccactgtgagtgccgcagcggctggactggcgtcaactgcgacgtgctcagtgtgtcc
tgtgaggtggctgcacagaagcgaggcattgacgtcactctcctgtgccagcatggaggg
ctctgtgtggatgagggagataaacattactgccactgccaggcaggctacacgggcagc
tactgtgaggacgaggtggacgagtgctcacctaacccctgccagaatggagctacctgc
actgactatctcggcggcttttcctgcaagtgtgtggctggctaccatgggtctaactgc
tccgaggagatcaacgagtgcctgtcccagccctgccagaatgggggtacctgcattgat
ctgaccaactcctacaagtgttcctgcccccgggggacacagggtgtacactgtgagatc
aatgttgatgactgccatcccccccttgaccctgcctcccgaagccccaagtgcttcaac
aatggcacctgtgtggaccaggtgggtggctatacctgcacctgcccaccaggcttcgtc
ggggagcggtgtgagggtgatgtcaatgaatgtctctccaacccctgtgacccacgtggc
acccagaactgtgtgcagcgtgttaatgacttccactgcgagtgccgggctggccacact
ggacgccgctgtgagtcagtcatcaatggctgcaggggcaaaccttgcaagaatgggggt
gtctgtgccgtggcctccaacaccgcccgtggattcatctgtaggtgccctgcgggcttc
gagggtgccacatgtgagaatgatgcccgcacttgtggcagcttacgctgcctcaacggt
ggtacatgcatctcgggcccacgtagtcccacctgcctatgcctgggatccttcaccggc
cctgagtgccagttcccagccagcagcccctgtgtgggtagcaacccctgctacaatcag
ggcacctgtgagcccacatccgagaaccctttctaccgctgtctatgccctgccaaattc
aacgggctactgtgccacatcctggactacagcttcacaggtggcgctgggcgcgacatt
cccccaccgcagattgaggaggcctgtgagctgcctgagtgccaggtggatgcaggcaat
aaggtctgcaacctgcagtgtaataatcacgcatgtggctgggatggtggcgactgctcc
ctcaacttcaatgacccctggaagaactgcacgcagtctctacagtgctggaagtatttt
agcgacggccactgtgacagccagtgcaactcggccggctgcctctttgatggcttcgac
tgccagctcaccgagggacagtgcaaccccctgtatgaccagtactgcaaggaccacttc
agtgatggccactgcgaccagggctgtaacagtgccgaatgtgagtgggatggcctagac
tgtgctgagcatgtacccgagcggctggcagccggcaccctggtgctggtggtgctgctt
ccacccgaccagctacggaacaactccttccactttctgcgggagctcagccacgtgctg
cacaccaacgtggtcttcaagcgtgatgcgcaaggccagcagatgatcttcccgtactat
ggccacgaggaagagctgcgcaagcacccaatcaagcgctctacagtgggttgggccacc
tcttcactgcttcctggtaccagtggtgggcgccagcgcagggagctggaccccatggac
atccgtggctccattgtctacctggagatcgacaaccggcaatgtgtgcagtcatcctcg
cagtgcttccagagtgccaccgatgtggctgccttcctaggtgctcttgcgtcacttggc
agcctcaatattccttacaagattgaggccgtgaagagtgagccggtggagcctccgctg
ccctcgcagctgcacctcatgtacgtggcagcggccgccttcgtgctcctgttctttgtg
ggctgtggggtgctgctgtcccgcaagcgccggcggcagcatggccagctctggttccct
gagggtttcaaagtgtcagaggccagcaagaagaagcggagagagcccctcggcgaggac
tcagtcggcctcaagcccctgaagaatgcctcagatggtgctctgatggacgacaatcag
aacgagtggggagacgaagacctggagaccaagaagttccggtttgaggagccagtagtt
ctccctgacctgagtgatcagactgaccacaggcagtggacccagcagcacctggacgct
gctgacctgcgcatgtctgccatggccccaacaccgcctcagggggaggtggatgctgac
tgcatggatgtcaatgttcgaggaccagatggcttcacacccctcatgattgcctcctgc
agtggagggggccttgagacaggcaacagtgaagaagaagaagatgcacctgctgtcatc
tctgacttcatctaccagggcgccagcttgcacaaccagacagaccgcaccggggagacc
gccttgcacttggctgcccgatactctcgttcagatgctgcaaagcgcttgctggaggcc
agtgcagatgccaacatccaggacaacatgggccgtactccgttacatgcagcagtttct
gcagatgctcagggtgtcttccagatcctgctccggaacagggccacagatctggatgcc
cgaatgcatgatggcacaactccactgatcctggctgcgcgcctggccgtggagggcatg
ctggaggacctcatcaactcacatgctgacgtcaatgccgtggatgacctaggcaagtcg
gctttgcattgggcggccgcggtgaacaatgtggatgctgctgttgtgctcctgaagaac
ggagccaacaaggacatgcagaacaacaaggaggagactcccctgttcctggccgcccgt
gagggcagctatgagactgccaaagtgttgctggaccactttgccaaccgggacatcacg
gatcacatggaccgattgccgcgggacatcgcacaggagcgtatgcaccacgatatcgtg
cggcttttggatgagtacaacctggtgcgcagcccacagctgcatggcactgccctgggt
ggcacacccactctgtctcccacactctgctcgcccaatggctacctgggcaatctcaag
tctgccacacagggcaagaaggcccgcaagcccagcaccaaagggctggcttgtggtagc
aaggaagctaaggacctcaaggcacggaggaagaagtcccaggatggcaagggctgcctg
ttggacagctcgagcatgctgtcgcctgtggactccctcgagtcaccccatggctacttg
tcagatgtggcctcgccacccctcctcccctccccattccagcagtctccatccatgcct
ctcagccacctgcctggtatgcctgacactcacctgggcatcagccacttgaatgtggca
gccaagcctgagatggcagcactggctggaggtagccggttggcctttgagccacccccg
ccacgcctctcccacctgcctgtagcctccagtgccagcacagtgctgagtaccaatggc
acgggggctatgaatttcaccgtgggtgcaccggcaagcttgaatggccagtgtgagtgg
cttccccggctccagaatggcatggtgcccagccagtacaacccactacggccgggtgtg
acgccgggcacactgagcacacaggcagctggcctccagcatagcatgatggggccacta
cacagcagcctctccaccaataccttgtccccgattatttaccagggcctgcccaacaca
cggctggcaacacagcctcacctggtgcagacccagcaggtgcagccacagaacttacag
ctccagcctcagaacctgcagccaccatcacagccacacctcagtgtgagctcggcagcc
aatgggcacctgggccggagcttcttgagtggggagcccagtcaggcagatgtacaaccg
ctgggccccagcagtctgcctgtgcacaccattctgccccaggaaagccaggccctgccc
acatcactgccatcctccatggtcccacccatgaccactacccagttcctgacccctcct
tcccagcacagttactcctcctcccctgtggacaacacccccagccaccagctgcaggtg
ccagagcaccccttcctcaccccatcccctgagtcccctgaccagtggtccagctcctcc
ccgcattccaacatctctgattggtccgagggcatctccagcccgcccaccaccatgccg
tcccagatcacccacattccagaggcatttaaataa

KEGG   Mus musculus (mouse): 18129Help
Entry
18129             CDS       T01002                                 

Gene name
Notch2, AI853703, N2
Definition
(RefSeq) notch 2
  KO
K20994  Notch 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18129 (Notch2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    18129 (Notch2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18129 (Notch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18129 (Notch2)
   05206 MicroRNAs in cancer
    18129 (Notch2)
  09162 Cancer: specific types
   05224 Breast cancer
    18129 (Notch2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18129 (Notch2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18129 (Notch2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 DUF3454 Notch NOD Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 18129
NCBI-ProteinID: NP_035058
MGI: 97364
Ensembl: ENSMUSG00000027878
Vega: OTTMUSG00000053240
UniProt: O35516
LinkDB All DBs
Position
3 F2.2; 3 42.42 cM
AA seq 2473 aa AA seqDB search
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGFCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSRDTYECTCQVGFTGKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCE
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
EKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCAS
NPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSTLRCWEYINNQCDEQCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQKMTRRSLPEEQEQEQEV
IGSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESPRNAQL
LYLLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLK
NLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEDDPIDRRPWTQQHLEAADI
RHTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANII
TDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVA
ADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKS
ALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDIT
DHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPM
GKKARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHT
YVSDATSSPMITSPGILQASPTPLLAAAAPAAPVHTQHALSFSNLHDMQPLAPGASTVLP
SVSQLLSHHHIAPPGSSSAGSLGRLHPVPVPADWMNRVEMNETQYSEMFGMVLAPAEGAH
PGIAAPQSRPPEGKHMSTQREPLPPIVTFQLIPKGSIAQAAGAPQTQSSCPPAVAGPLPS
MYQIPEMPRLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAA
ERTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTH
MSEPPHSNMQVYA
NT seq 7422 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctctgcgtcccgccgcgctgcgggcgctgctgtggctctggctgtgcggcgcg
ggccccgcgcacgctttgcagtgtcgaggtggtcaagagccctgtgtaaatgaagggacc
tgtgttacctaccacaacggcacaggcttctgccgatgtccagagggcttcttgggagaa
tattgccaacatcgagacccctgtgagaaaaaccgctgtcagaatggtggtacttgtgtg
ccgcagggcatgttggggaaagctacctgccgatgtgctccaggattcacaggagaggac
tgccaatactccacctctcacccctgctttgtgtcccgcccttgtcagaatgggggtacc
tgtcacatgctcagccgggacacctacgagtgcacctgccaagtcggcttcacagggaag
cagtgtcagtggacagatgcctgtctatctcatccctgcgaaaatggaagcacctgtaca
tctgtggccagccagttctcctgcaaatgccctgcaggcctcacagggcagaagtgtgaa
gctgatatcaatgagtgtgacattccaggacgctgccaacatggtggcacctgcctcaac
cttcctggttcctacagatgccaatgtcctcagggcttcacaggccagcactgtgacagc
ccttatgtgccctgtgcaccctcgccctgcgtcaacggaggcacctgtcgtcagactggc
gacttcactttcgaatgcaactgcctgccaggttttgaagggagcacctgtgagcggaat
atcgacgactgccccaaccacaagtgtcagaatggaggagtttgtgtggatggtgtcaat
acctacaattgccgctgtccccctcagtggactgggcagttctgcacagaagatgtggac
gagtgtctgttgcagcccaacgcttgtcagaatggaggcacctgcaccaaccgaaacgga
ggctatggctgcgtgtgtgtgaacggctggagcggagatgactgcagcgagaatatcgat
gactgtgcctatgcttcctgcacgccagggtccacctgcattgaccgcgtggcctccttc
tcctgcctgtgtccggagggaaaggcgggtctcctgtgccatctggatgatgcctgtatc
agcaacccttgtcacaagggggcgctgtgtgacaccaaccccctgaacgggcagtacatt
tgcacctgcccacagggctacaagggcgctgactgcacagaagacgtggatgagtgtgct
atggccaacagtaacccttgtgagcatgcaggaaagtgtgtgaatacagatggcgccttc
cactgtgagtgtctgaagggctacgcagggcctcgctgtgagatggacatcaacgagtgt
cattcagacccctgccagaacgacgccacctgcctggataagatcggaggcttcacctgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgagctggaggtaaatgaatgccagagc
aacccgtgtgtgaacaacgggcagtgtgtggacaaagtcaaccgcttccagtgtctgtgt
ccccctggcttcacaggaccagtgtgccagatcgacattgatgactgctccagtactccc
tgcctgaatggggccaagtgcatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggcatattgtgtgatgagaacatcgacaactgtgacccagatccttgccac
catggccagtgccaggatgggatcgactcctacacctgcatctgcaaccctgggtacatg
ggagccatctgtagtgaccagattgatgaatgctacagcagcccttgcttgaacgatggg
cgctgcattgacctggtgaatggttaccagtgcaactgccaaccaggcacatcaggcctt
aattgtgaaattaattttgatgactgtgccagcaacccttgtatgcacggagtctgtgtg
gacggcatcaatcgctacagctgtgtgtgctctccgggattcacaggccagaggtgcaat
attgacattgatgagtgtgcctccaacccctgtcgcaagggtgcgacgtgcatcaatgat
gtgaatggtttccggtgtatatgccccgagggaccgcatcatcctagctgctactcacag
gtgaacgagtgcctgagcaatccctgcatccacggaaactgtactggaggtctcagtggc
tataagtgcctctgcgatgcaggctgggttggtgtcaactgtgaggtggacaaaaatgag
tgtctttctaacccatgccagaatggaggaacgtgcaataacctggtgaatggctacagg
tgtacctgcaagaaggggttcaaaggctacaactgccaggtgaatatagatgagtgtgcc
tccaacccgtgtctgaaccaaggaacctgctttgatgacgtcagtggctacacttgccac
tgcatgttgccttacacaggcaagaactgtcaaacagtgttggctccctgttccccaaac
ccgtgtgagaatgctgctgtttgtaaagaggcacccaattttgagagcttcagctgcttg
tgtgctcctggctggcaaggtaaacgatgtacagttgacgttgatgagtgtatctccaag
ccgtgtatgaacaatggtgtctgccacaacactcagggcagctacgtgtgtgagtgtcct
cccggcttcagtgggatggactgtgaagaggacatcaatgattgccttgccaacccctgc
cagaacggaggctcctgtgtggaccatgtgaataccttctcctgccagtgccatcctggc
ttcataggggacaagtgccagacagacatgaatgagtgtctgagcgagccctgtaagaat
ggggggacctgctccgactatgtcaacagttacacctgcacatgccctgcgggcttccac
ggagtccactgtgaaaacaacattgacgagtgcactgagagctcctgcttcaatggcggc
acgtgtgttgatggaatcaactctttctcttgcttgtgccccgtgggtttcactggtccc
ttctgcctccatgatatcaatgagtgcagctctaacccgtgcctgaatgctggaacgtgt
gttgatggtctgggtacctaccgatgcatctgtcccttgggctacaccgggaaaaactgt
cagaccctggtgaacctctgcagccggtctccgtgtaaaaacaaaggaacttgtgttcag
gaaaaggcaaggccccactgtctgtgtccgcctggatgggatggtgcatactgtgatgtg
ctcaacgtgtcctgtaaggcggcagccttgcagaaaggagtacctgttgaacacttgtgc
cagcactcgggcatctgtatcaatgctggcaacacccatcactgccagtgccccctgggc
tacacggggagctactgcgaggagcagcttgatgagtgtgcatccaatccatgccagcac
ggtgccacctgcaatgacttcatcggaggatacagatgtgagtgtgttccaggatatcag
ggtgtcaactgtgagtatgaagtggacgagtgccagaaccaaccctgccagaatggaggc
acctgcatcgaccttgtgaaccatttcaagtgttcgtgtcccccaggcacccggggcctg
ctgtgtgaagagaacatcgatgaatgtgctgggggcccccactgccttaacggtggccag
tgcgtggaccggattggaggctacacttgtcgctgtttgcctggctttgctggggagcgg
tgtgagggggacatcaacgaatgcctgtccaacccttgcagctcagagggcagcctggac
tgcgttcagctcaaaaataactacaactgtatctgccgcagcgccttcacgggccggcac
tgtgaaaccttcctagatgtgtgtccccagaagccttgcctgaacggagggacttgtgcc
gtggctagcaacatgcccgatggcttcatctgtcgttgtcccccagggttctctggggcg
agatgccagagcagctgtggacaagtgaagtgcaggagaggggagcagtgtatccacact
gactcgggacctcgctgcttctgcctgaaccccaaggactgcgagtcaggatgtgccagt
aacccctgccagcatgggggcacctgctatcctcagcgccagcctcctcactattcctgc
cgctgccctccgtcgttcgggggcagccactgcgaactctacacagcccccaccagcacc
cctcctgctacctgtcagagtcagtactgcgccgacaaggctcgggatggcatctgtgac
gaggcctgcaatagtcatgcctgccagtgggatggaggtgactgttccctcactatggag
gacccctgggccaactgcacctccactcttcgctgctgggaatacatcaacaaccagtgt
gatgagcagtgcaacaccgcagagtgcctgtttgacaactttgagtgccagaggaatagc
aagacgtgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgatcag
ggatgcaacagcgaggagtgtggctgggatgggctggactgcgcttcggaccagcctgag
aacctggcagagggcaccctgatcatcgtggtgctcctgccccctgaacagctgctgcag
gattcgcgaagcttcttgagggccctgggcaccctgctccacaccaacttgcgcattaaa
caagattctcagggcgctctcatggtgtacccctactttggggagaagtcagctgccatg
aagaagcagaagatgacacgcaggtctcttcctgaggagcaggagcaggagcaggaggtg
ataggctctaagatatttctggagatcgacaaccgacagtgtgttcaagattcagaccag
tgcttcaaaaacacagatgcggcagctgctctcctggcttctcatgccatccaagggacc
ctatcctaccctctagtgtctgttttcagtgaactggagagtccaagaaacgcccagctt
ctctatctgctcgcggtcgctgttgtcatcatcctgttcttcatcctgctgggggtcatc
atggccaagcggaagcgcaagcatggcttcctctggctgccggaagggttcaccctccgc
cgagactctagcaatcacaagcgccgtgaacctgtgggacaggatgccgtggggctgaaa
aatctctccgtgcaagtgtcagaggctaacctgattggttctgggacaagtgaacattgg
gttgatgatgaaggaccccagccaaagaaagccaaggctgaggatgaggctttgctgtcg
gaagatgaccccatcgatcgacggccctggacacagcagcaccttgaagctgcagacatc
cgccacactccatccctggcactcactcctcctcaggcagaacaggaggtggacgtgctg
gacgtgaatgtccgaggcccagatgggtgtactccactgatgctggcttctctccgagga
ggcagctcagacctgagtgatgaagacgaagatgctgaggactcttctgccaacatcatc
acagacttggtctaccaaggtgccagccttcaagcacagacagaccgcactggcgagatg
gccctgcaccttgcagcccgctattcgagagctgatgctgccaaacgcctcctggatgct
ggtgcggatgcaaatgcccaggacaacatgggccgatgtcctcttcacgctgcggtggca
gcagacgcccaaggtgtctttcagattctgatccgcaaccgtgtaaccgatctggatgcc
agaatgaacgatggtactacccccctgatcctggctgcccgcctggctgtggaaggaatg
gtggcagagttgatcaattgccaagcagatgtcaatgcagtggatgaccatggaaaatct
gccctccactgggcagctgctgtcaataatgtggaggcgactcttctgctgttgaagaat
ggggccaacagagatatgcaggacaataaggaagagacacctttgtttcttgctgcccga
gagggaagttatgaagcggccaaaatcctgttagaccattttgccaaccgggacatcact
gaccacatggaccgccttccccgggatgtggctcgggaccgcatgcaccatgacatcgtt
cgcctcctggacgagtataacgtgactcccagccctccgggaacggtcttgacttctgcg
ctctcacctgtcctctgtgggcccaacaggtctttcctcagtctgaagcacaccccaatg
ggtaagaaggctaggcggcccaacaccaagagcaccatgcccacgagcctgcctaacctt
gccaaggaggccaaggatgccaagggcagcaggaggaagaagtgtctgaacgagaaggtc
cagctgtccgagagctcagtgactctatcccccgtcgattcgctcgagtctcctcacacg
tatgtctccgatgccacatcctctcccatgatcacatcccctggaatcttacaggcctcg
cccacccccctgctggctgctgccgccccggctgccccagtgcacacacagcatgcgctg
tctttctctaaccttcatgacatgcagcctttggctcctggagccagcaccgtgctcccc
tcggtcagccagctgctatcccaccaccacatcgcgcccccaggtagtagcagtgcagga
agcttgggcaggttacatccagttcctgtcccagcagactggatgaaccgtgtggagatg
aacgagacccagtacagtgaaatgtttggcatggtcctggctcctgcagagggagcccac
cctggcatagcagctccccagagcagacctccggaagggaagcacatgtccacccagcgg
gagcccttgcctcccatcgtgactttccagcttatcccaaaaggcagcattgcccaggca
gccggagctccccagacgcagtccagttgccctccagctgttgcaggccccttgccctct
atgtaccagatcccagagatgccccgtttgcccagtgtggctttcccacctaccatgatg
ccccagcaggaggggcaggtagctcagaccattgtgccaacctatcatcctttcccagcc
tctgtgggcaagtaccccacacccccttcccaacacagttacgcctcctcaaatgctgct
gagcgaacccccagtcatggtggtcacctccagggcgagcacccatacctgacaccatcc
ccagagtctcctgaccaatggtcaagctcttcaccacactctgcatctgactggtcagat
gtgaccaccagcccaactcctggaggtggtggaggcggtcagcggggacccggaacacac
atgtccgagccaccacacagcaacatgcaggtgtatgcatga

KEGG   Mus musculus (mouse): 18131Help
Entry
18131             CDS       T01002                                 

Gene name
Notch3, AW229011, N3, hpbk
Definition
(RefSeq) notch 3
  KO
K20995  Notch 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04371  Apelin signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18131 (Notch3)
   04371 Apelin signaling pathway
    18131 (Notch3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    18131 (Notch3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18131 (Notch3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18131 (Notch3)
   05206 MicroRNAs in cancer
    18131 (Notch3)
  09162 Cancer: specific types
   05224 Breast cancer
    18131 (Notch3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18131 (Notch3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18131 (Notch3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Notch EGF_2 Ank Ank_5 NODP NOD DUF3454 Ank_4 Ank_3 cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 18131
NCBI-ProteinID: NP_032742
MGI: 99460
Ensembl: ENSMUSG00000038146
Vega: OTTMUSG00000030086
UniProt: Q61982
LinkDB All DBs
Position
17 B1; 17 17.37 cM
AA seq 2318 aa AA seqDB search
MGLGARGRRRRRRLMALPPPPPPMRALPLLLLLAGLGAAAPPCLDGSPCANGGRCTHQQP
SLEAACLCLPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCLRGFQGPDCSQ
PDPCVSRPCVHGAPCSVGPDGRFACACPPGYQGQSCQSDIDECRSGTTCRHGGTCLNTPG
SFRCQCPLGYTGLLCENPVVPCAPSPCRNGGTCRQSSDVTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNLLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVSGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGSMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGIRCESQVDECRSQPCRYGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGEGGSCVDGENGFHCLCPPGSLPPLCLPANHPCAHKPCSHGVCHDAPGGFRCV
CEPGWSGPRCSQSLAPDACESQPCQAGGTCTSDGIGFRCTCAPGFQGHQCEVLSPCTPSL
CEHGGHCESDPDRLTVCSCPPGWQGPRCQQDVDECAGASPCGPHGTCTNLPGNFRCICHR
GYTGPFCDQDIDDCDPNPCLHGGSCQDGVGSFSCSCLDGFAGPRCARDVDECLSSPCGPG
TCTDHVASFTCACPPGYGGFHCEIDLPDCSPSSCFNGGTCVDGVSSFSCLCRPGYTGTHC
QYEADPCFSRPCLHGGICNPTHPGFECTCREGFTGSQCQNPVDWCSQAPCQNGGRCVQTG
AYCICPPGWSGRLCDIQSLPCTEAAAQMGVRLEQLCQEGGKCIDKGRSHYCVCPEGRTGS
HCEHEVDPCTAQPCQHGGTCRGYMGGYVCECPAGYAGDSCEDNIDECASQPCQNGGSCID
LVARYLCSCPPGTLGVLCEINEDDCDLGPSLDSGVQCLHNGTCVDLVGGFRCNCPPGYTG
LHCEADINECRPGACHAAHTRDCLQDPGGHFRCVCHPGFTGPRCQIALSPCESQPCQHGG
QCRHSLGRGGGLTFTCHCVPPFWGLRCERVARSCRELQCPVGIPCQQTARGPRCACPPGL
SGPSCRVSRASPSGATNASCASAPCLHGGSCLPVQSVPFFRCVCAPGWGGPRCETPSAAP
EVPEEPRCPRAACQAKRGDQNCDRECNTPGCGWDGGDCSLNVDDPWRQCEALQCWRLFNN
SRCDPACSSPACLYDNFDCYSGGRDRTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLD
CASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDARGQAMVFPYH
RPSPGSESRVRRELGPEVIGSVVMLEIDNRLCLQSAENDHCFPDAQSAADYLGALSAVER
LDFPYPLRDVRGEPLEAPEQSVPLLPLLVAGAVFLLIIFILGVMVARRKREHSTLWFPEG
FALHKDIAAGHKGRREPVGQDALGMKNMAKGESLMGEVVTDLNDSECPEAKRLKVEEPGM
GAEEPEDCRQWTQHHLVAADIRVAPATALTPPQGDADADGVDVNVRGPDGFTPLMLASFC
GGALEPMPAEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLL
DAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVE
GMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLA
AREGSYEAAKLLLDHLANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPSGPHGL
GPLLCPPGAFLPGLKAVQSGTKKSRRPPGKTGLGPQGTRGRGKKLTLACPGPLADSSVTL
SPVDSLDSPRPFSGPPASPGGFPLEGPYATTATAVSLAQLGASRAGPLGRQPPGGCVLSF
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGAPVSPQERPPPYLAAPGHGEE
YPAAGTRSSPTKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATNAT
ASGALPAQPHPISVPSLPQSQTQLGPQPEVTPKRQVMA
NT seq 6957 nt NT seq  +upstreamnt  +downstreamnt
atggggctgggggcccggggccgccgccgccgtcgtcgcctgatggccttgccaccgcca
ccaccgcccatgcgggcgctgcccctgctgctgctgctagcggggctgggggctgcagca
cccccttgtctggatggaagcccatgtgcaaatggaggtcggtgcacccaccagcagccc
tccctggaggctgcttgcctgtgcctgccaggctgggtgggtgagcggtgccagctggaa
gacccttgccactcaggcccttgtgctggccgaggcgtttgccagagttcagtggtggcg
ggcaccgcccgattctcctgtcgttgtctccgtggcttccaaggcccagactgctcccag
ccagacccctgcgtcagcaggccctgtgttcatggtgccccctgctcagtggggccggat
ggccgatttgcctgtgcctgcccacctggctaccagggtcaaagctgccaaagtgacata
gatgagtgccgatctggtacaacttgccgtcatggtggtacctgtctcaatacacctgga
tccttccgctgccagtgtcctcttggttatacagggctgctgtgtgagaaccccgtagtg
ccctgtgccccttccccgtgtcgtaatggtggcacctgtaggcagagcagtgatgtcaca
tatgactgtgcttgccttcctggcttcgagggccagaactgtgaagtcaacgtggatgac
tgtcctggacatcggtgtctcaatgggggaacgtgtgtagacggtgtcaatacttacaac
tgccagtgccctccggagtggacaggccagttctgtacagaagatgtggatgagtgtcag
ctgcagcccaatgcctgccacaatgggggtacctgcttcaacctactgggtggccacagc
tgtgtatgtgtcaatggctggacgggtgagagctgcagtcagaatatcgatgactgtgct
acagccgtgtgtttccatggggccacctgccatgaccgtgtggcctctttctactgtgcc
tgccctatggggaagacaggcctcttgtgtcatctggatgatgcatgtgtcagcaacccc
tgccatgaggatgctatctgtgacacaaaccctgtgagtggccgggccatctgcacctgc
ccacctggcttcactggaggggcatgtgaccaggatgtggatgagtgctcgattggtgcc
aacccctgtgaacatttgggtcggtgtgtgaatacacagggctcattcttgtgccaatgt
ggccgtggctatactggacctcgctgtgagactgatgtcaatgagtgtctctccgggccc
tgccgcaaccaggccacgtgtcttgaccgaattggccagtttacttgcatctgcatggca
ggcttcacagggacctactgtgaggtggacatcgacgaatgtcagagcagcccatgtgtc
aatggtggtgtctgcaaggacagagtcaatggcttcagctgcacctgcccatcaggattc
agtgggtccatgtgtcagctggatgtggatgagtgtgcaagcactccctgccggaatggt
gccaagtgtgtggaccagcctgacggctatgagtgtcgctgtgcagagggctttgagggc
actttgtgtgagcgaaacgtggatgactgctctccggatccctgccaccacgggcgctgt
gtcgatggcattgctagcttctcgtgtgcttgtgccccaggctatacgggcatacgctgt
gagagccaggtggatgagtgccgcagccagccctgtcgatatgggggcaaatgtctagac
ttggtggacaagtacctctgccgttgtcctcccggaaccacaggtgtgaactgtgaagtc
aacattgatgactgtgccagtaacccctgtacctttggagtttgccgtgatggcatcaac
cgttatgactgtgtctgtcagcctggattcacagggcccctctgcaacgtggagatcaat
gagtgtgcatccagcccatgtggagagggtggctcctgtgtggatggggaaaatggcttc
cactgcctctgtccacctggctccctgcctccactttgcctacctgcgaaccatccctgt
gcccacaagccctgtagtcatggagtctgccatgatgcaccaggcgggttccgctgtgtt
tgtgagcccgggtggagtggccctcgctgtagccagagcctggctccagatgcctgtgag
tcccagccctgccaggctggtggcacctgcaccagtgatggaataggctttcgctgcacc
tgtgcccctggattccagggccatcagtgtgaggtgctgtccccctgtactccaagcctc
tgtgagcacggaggccactgtgagtctgaccctgaccggctgactgtctgttcctgtccc
ccaggctggcaaggcccacgatgccagcaggatgtggatgaatgtgccggtgcctcaccc
tgcggcccccatggtacctgcaccaacctgccagggaatttcaggtgcatctgccacagg
ggatacactggccccttctgtgatcaagacattgacgactgtgaccccaacccgtgcctc
catggtggctcctgccaggatggcgtgggctccttttcctgttcttgcctcgacggcttt
gctggtcctcgctgtgcccgagatgtggacgaatgtctgagcagcccctgtggccctggc
acctgtactgatcacgtggcctccttcacctgtgcctgtccacctggttatggaggcttc
cactgtgagattgacttgccggactgcagccccagttcctgcttcaatggagggacctgt
gtggatggcgtgagctccttcagctgtctgtgtcgccccggctacacaggcacacactgc
caatacgaggctgacccctgcttttcccggccctgtctgcacgggggcatctgcaacccc
acccacccaggatttgaatgcacctgccgggagggcttcactgggagtcagtgtcagaac
ccagtggactggtgcagccaggcaccctgtcagaatgggggtcgctgtgtccagactggg
gcttactgcatttgtccacctggatggagtggccgcctgtgcgacatacaaagcctgccc
tgcacggaggccgcagcccagatgggggtgaggttggagcagctgtgtcaggaaggtgga
aagtgcatagacaagggccgctcccactactgtgtgtgtccagagggccgtacgggtagt
cactgtgaacacgaggtggatccctgcacggcccagccttgccagcacgggggcacttgc
cgtggttacatggggggctatgtgtgtgagtgtccagctggctatgctggtgacagttgt
gaggataatatagatgagtgtgcttcccagccctgccagaacggaggctcctgtatcgat
cttgtggcccgctatctctgttcctgtccccctggcacactgggagttctctgtgagatc
aatgaggacgactgtgacctaggcccatccttggactcaggcgttcagtgcctacacaat
ggcacctgtgtggacctggtgggtggcttccgctgtaactgtcccccaggatacacaggt
ctgcactgtgaggcagacatcaatgagtgtcgcccgggtgcctgccatgcagcgcatact
cgggactgcctacaagatccaggtgggcatttccgctgcgtctgccatcctggcttcaca
gggcctcgctgtcagattgctctgtccccctgtgagtcccagccatgtcagcatggaggc
cagtgccgtcacagcctaggccgtggaggtgggctgaccttcacctgtcactgtgtcccg
ccattctggggtctgcgttgtgagcgggtggcacgctcttgccgagagctgcagtgccca
gtgggtatcccatgccagcagacagcccgtggaccacgctgcgcttgtcctccggggctg
tccgggccctcctgccgggtttctagggcgtcaccctcaggagctactaacgccagctgc
gcctctgccccttgtctgcatgggggctcatgcctacctgtacagagtgtccctttcttc
cgctgtgtgtgcgctccgggctggggcggcccgcgttgtgagaccccttccgcagcccct
gaggtccccgaggagccacggtgcccgcgagcggcttgccaggccaagcgaggggaccag
aactgcgatcgtgagtgcaacaccccaggctgtggctgggatggcggtgactgctcactg
aacgtggacgacccctggaggcagtgtgaggcactgcagtgctggcgtctcttcaacaac
agccggtgtgacccggcctgcagctctccagcctgcctctatgacaactttgactgctac
tctggtggccgcgaccgcacctgcaaccctgtttatgagaagtactgcgccgaccacttt
gcagatggccgttgtgaccagggctgcaacactgaggaatgcggctgggatgggctggac
tgtgccagcgaggtcccggcccttttggcccgaggggttctggtcctcacagttcttctg
cctcctgaagagttgctgcgctccagtgccgactttctgcagcgactcagcgctattctg
cgcacctcactgcgcttccgcttggacgcacgtggccaggccatggtcttcccctatcac
cggccaagccctggctctgaatcccgggtccgtcgtgagctgggtcctgaggtgatcggc
tctgtggtgatgctggagattgacaaccggctctgtctgcagtcagctgagaatgaccac
tgcttccctgatgcccagagtgctgctgactacctgggagccttgtcagcagtggagcga
cttgatttcccatacccacttcgggatgtgcgaggagagccgctggaggccccagagcag
agcgtgccactgctgccactgctggtggcaggggctgtctttctactcatcatcttcatc
ctgggtgtcatggttgccaggcgaaagcgagaacacagcaccctctggttccctgagggt
tttgcattacacaaggacatagctgctggccacaagggccggagggagcctgtgggacaa
gatgcactgggaatgaagaacatggccaagggtgagagtctgatgggggaggtggtcaca
gacttgaatgactcagaatgtccagaggccaagagactgaaggtagaggagccgggcatg
ggtgcagaggagcctgaggactgtcgccagtggacccaacaccacctggttgctgctgat
atccgtgtggcaccagccacagcgctgactcctcctcagggagatgcagatgcagacgga
gtggatgtcaacgtccgagggcctgatggcttcaccccacttatgctggcctccttctgt
gggggagccctggagccgatgccagctgaggaggatgaggcggatgacacatcagccagc
attatctcagatctgatctgtcaaggggcccagctcggggcacggactgaccgcactggc
gagaccgccctgcatttggctgcccgctatgctagagcggatgcagccaagcgtctcctg
gatgctggggcggacaccaacgcccaggatcattcgggccgcacccccctgcacaccgca
gtgacagctgatgcccagggtgtcttccagattctcatcaggaaccgctccactgacctg
gatgcccgaatggcagatggctctactgcactgatcctggcagcccgcctggcagtggag
ggcatggtggaagagctcatcgccagccatgccgatgtcaatgcagtggatgagcttggg
aaatctgccttacactgggctgcagctgtgaacaacgtggaggctaccttggctctgctg
aaaaatggagccaacaaggacatgcaggacagcaaggaagagacgccgctgttcttggcc
gctcgggagggcagctatgaggctgccaagctgctgctggatcatctcgccaaccgggag
atcacagatcacttggacaggctgccccgggacgtggcccaggagcggctgcaccaggac
attgtgcggttgctggaccagcccagtggacctcgaagtccctctggtccccatggctta
gggccattgctctgcccaccaggggccttccttcctggcctcaaagcggtgcagtctggg
accaagaagagcaggaggccacctggcaagaccgggctggggccacagggaactcgtggt
cggggcaagaagctgacactagcctgtccaggacctctggcagacagctctgtcacactg
tcaccggtggactctctggactcaccacggcctttcagtgggccccctgcttcccctgga
ggcttccccttggagggcccctatgccaccacggccaccgcggtgtccttggcacagcta
ggcgcaagtagggcgggtcctctggggcgccagcctcctgggggctgtgtgctcagcttt
ggtctgctcaatcctgtagctgttcccctcgactgggccaggctgcctccacctgcccct
ccagggccctcattcctgctgcccctggctccgggaccccagttgctcaacccaggagcc
ccagtttctccccaagagcggcccccaccctacctggctgctccaggacatggagaggaa
tatcctgcagcaggaacccgcagtagccccaccaaggcccgcttcctgcgggttcccagc
gagcatccttatttgaccccgtctcctgagtccccagagcactgggccagcccatccccc
ccatccctctcagactggtctgactcaacacctagcccagcaactgctaccaatgccaca
gcctctggagccctgcctgctcagccacaccccatatctgttccctccctccctcagtcc
cagactcagctgggaccccaaccagaagttacccccaagaggcaggtgatggcctaa

KEGG   Mus musculus (mouse): 18132Help
Entry
18132             CDS       T01002                                 

Gene name
Notch4, Int-3, Int3, N4
Definition
(RefSeq) notch 4
  KO
K20996  Notch 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04330  Notch signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    18132 (Notch4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    18132 (Notch4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18132 (Notch4)
   05206 MicroRNAs in cancer
    18132 (Notch4)
  09162 Cancer: specific types
   05224 Breast cancer
    18132 (Notch4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    18132 (Notch4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    18132 (Notch4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_5 Ank Ank_2 Notch Ank_3 Ank_4 EGF_2 NODP NOD EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 18132
NCBI-ProteinID: NP_035059
MGI: 107471
Ensembl: ENSMUSG00000015468
Vega: OTTMUSG00000020242
UniProt: P31695
LinkDB All DBs
Position
17 B1; 17 18.15 cM
AA seq 1964 aa AA seqDB search
MQPQLLLLLLLPLNFPVILTRELLCGGSPEPCANGGTCLRLSRGQGICQCAPGFLGETCQ
FPDPCRDTQLCKNGGSCQALLPTPPSSRSPTSPLTPHFSCTCPSGFTGDRCQTHLEELCP
PSFCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANGGVCLATYPQIQCRCP
PGFEGHTCERDINECFLEPGPCPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSC
LNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCP
KTWKGWDCSEDIDECEARGPPRCRNGGTCQNTAGSFHCVCVSGWGGAGCEENLDDCAAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPG
YSGSTCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAACHDLLNGFQCLCLPGF
TGARCEKDMDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDPCPVGAS
CLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAED
NCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG
LTCSEEVTACHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSASCLNGGTCV
NKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQT
LIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNG
GLCIDTGSSYFCRCPPGFQGKLCQDNVNPCEPNPCHHGSTCVPQPSGYVCQCAPGYEGQN
CSKVLDACQSQPCHNHGTCTSRPGGFHCACPPGFVGLRCEGDVDECLDRPCHPSGTAACH
SLANAFYCQCLPGHTGQRCEVEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTC
SHKALSCGIHHCHNGGLCLPSPKPGSPPLCACLSGFGGPDCLTPPAPPGCGPPSPCLHNG
TCTETPGLGNPGFQCTCPPDSPGPRCQRPGASGCEGRGGDGTCDAGCSGPGGDWDGGDCS
LGVPDPWKGCPPHSQCWLLFRDGRCHPQCDSEECLFDGYDCEIPLTCIPAYDQYCRDHFH
NGHCEKGCNNAECGWDGGDCRPEGEDSEGRPSLALLVVLRPPALDQQLLALARVLSLTLR
VGLWVRKDSEGRNMVFPYPGTRAKEELSGARDSSSWERQAPPTQPLGKETESLGAGFVVV
MGVDLSRCGPEHPASRCPWDSGLLLRFLAAMAAVGALEPLLPGPLLAAHPQAGTRPSANQ
LPWPILCSPVVGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPQTQQAPHRRRPPL
GEDNIGLKALKPEAEVDEDGVAMCSGPEEGEAEETASASRCQLWPLNSGCGELPQAAMLT
PPQECESEVLDVDTCGPDGVTPLMSAVFCGGVQSTTGASPQRLGLGNLEPWEPLLDRGAC
PQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQL
LLASRQTTVDARTEDGTTPLMLAARLAVEDLVEELIAARADVGARDKRGKTALHWAAAVN
NARAARSLLQAGADKDAQDSREQTPLFLAAREGAVEVAQLLLELGAARGLRDQAGLAPGD
VARQRSHWDLLTLLEGAGPTTQEARAHARTTPGGGAAPRCRTLSAGARPRGGGACLQART
WSVDLGARGGKVYARCRSRSGSCGGPTTRGRRFSAGSRGRRGARASQDDWPRDWVALEAC
GSACSAPIPPPSLTPSPERGSPQVAWGLPVHQEIPLNSVVRNLN
NT seq 5895 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagttgctgctgctgctgctcttgccactcaatttccctgtcatcctgacc
agagagcttctgtgtggaggatccccagagccctgtgccaacggaggcacctgcctgagg
ctatctcggggacaagggatctgccagtgtgcccctggatttctgggtgagacttgccag
tttcctgacccctgcagggatacccaactctgcaagaatggtggcagctgccaagccctg
ctccccacacccccaagctcccgtagtcctacttctccactgacccctcacttctcctgc
acctgcccctctggcttcaccggtgatcgatgccaaacccatctggaagagctctgtcca
ccttctttctgttccaacgggggtcactgctatgttcaggcctcaggccgcccacagtgc
tcctgcgagcctgggtggacaggtgagcaatgccagctccgagacttctgctcagccaac
ccctgtgccaacggaggcgtgtgcctggccacatacccccagatccagtgccgctgtcca
cctgggttcgagggtcacacctgtgaacgcgacatcaacgagtgcttcctggagccggga
ccctgccctcagggcacctcctgccataacaccttgggttcctaccagtgtctctgccct
gtggggcaggaaggtccccagtgcaagctcaggaagggagcctgccctcctggaagctgt
ctcaatgggggcacctgccagctggtcccagagggacactccacctttcatctctgcctc
tgtcccccaggtttcacggggctggactgtgagatgaacccagatgactgtgtcaggcac
cagtgtcagaacggggccacctgtctggatgggctggacacctacacctgcctctgcccc
aagacatggaagggctgggactgctctgaagatatagatgaatgtgaagcccggggtccc
cctcgctgcaggaacggtggcacctgccagaacacagctggcagctttcactgtgtgtgc
gtgagtggctggggaggcgcaggctgtgaggagaacctggatgactgtgcagctgccacc
tgtgccccgggatccacctgcatcgaccgtgtgggctccttctcctgcctctgcccacct
ggacgcacaggcctcctgtgccacctggaagacatgtgtttgagtcagccgtgccacgtg
aatgcccagtgcagcaccaaccctctgacaggctccaccctctgcatatgccagcctggc
tactcaggatccacctgtcaccaagatctggatgagtgccaaatggcccagcaaggaccc
agtccctgcgaacatggcggctcctgcatcaacacccctggctccttcaactgcctctgc
ctgcctggttacacgggctcccgctgtgaagctgaccacaatgagtgcctgtcacagccc
tgccacccaggcagcacctgcctggacctgcttgcaaccttccactgcctctgcccacca
ggcttggaagggaggctctgtgaggtggaggtcaatgagtgcacctctaatccctgcctg
aaccaagctgcctgccatgacctgctcaacggcttccagtgcctctgccttcctggattc
accggcgcccgatgtgagaaagacatggacgagtgtagcagcaccccctgtgccaatggg
gggcgctgccgagaccagcctggagccttctactgcgagtgtctcccaggctttgaaggg
ccacactgtgagaaagaagtggacgaatgtctgagtgacccctgccccgtgggagccagc
tgccttgatctccccggagcattcttctgcctctgccgtcctggtttcacaggtcaactt
tgtgaggttcccttgtgcacccccaacatgtgccaacctggacagcaatgccaaggtcag
gaacacagagccccctgcctctgccctgacggaagtcctggctgtgttcctgccgaggac
aactgcccctgtcaccatggccattgccagagatccttgtgtgtgtgtgatgagggctgg
actggaccagaatgcgagacagaactgggtggctgcatctccacaccctgtgcccatggg
gggacctgccacccacagccatctggctacaactgtacctgccctgcaggctacatgggg
ttgacctgtagtgaggaggtgacagcttgtcactcagggccctgtctcaatggtggctcc
tgcagcatccgtcctgagggctattcctgcacctgccttccaagtcacacaggtcgccac
tgccagactgccgtggaccactgtgtgtctgcctcgtgcctcaatgggggtacctgtgtg
aacaagcctggcactttcttctgcctctgtgccactggcttccaggggctgcactgtgag
gagaagactaaccccagctgtgcagacagcccctgcaggaacaaggcaacctgccaagac
acacctcgaggggcccgctgcctctgcagccctggctatacaggaagcagctgccagact
ctgatagacttgtgtgcccggaagccctgtccacacactgctcgatgcctccagagtggg
ccctcgttccagtgcctgtgcctccagggatggacaggggctctctgtgacttcccactg
tcctgccagaaggccgcgatgagccaaggcatagagatctctggcctgtgccagaatgga
ggcctctgtattgacacgggctcctcctatttctgccgctgccctcctggattccaaggc
aagttatgccaggataatgtgaacccctgtgagcccaatccctgccatcacgggtctacc
tgtgtgcctcagcccagtggctatgtctgccagtgtgccccaggctatgagggacagaac
tgctcaaaagtacttgacgcttgtcagtcccagccctgccacaaccacggaacctgtacc
tccaggcctggaggcttccactgtgcctgccctccaggcttcgtgggactgcgctgtgag
ggagatgtggatgagtgtctggaccggccctgtcacccctcgggcactgcagcttgccac
tctttagccaacgccttctactgccagtgtctgcctgggcacacaggccagcggtgtgag
gtggagatggacctctgtcagagccaaccctgctccaatggaggatcctgtgagatcaca
acagggccaccccctggcttcacctgtcactgccccaagggttttgaaggccccacctgc
agccacaaagccctttcctgcggcatccatcactgccacaatggaggcctatgtctgccc
tcccctaagccagggtcaccaccactctgtgcctgcctcagtggttttgggggccctgac
tgtctgacacctccagctccaccgggctgcggtcccccctcaccctgcctgcacaatggt
acctgcactgagacccctgggttgggcaacccgggctttcaatgcacctgccctcctgac
tctccagggccccggtgtcaaaggccaggggcaagtgggtgtgagggccgaggtggtgat
gggacctgcgatgctggctgcagtggcccaggaggagactgggatggaggggactgttcc
ctgggggtcccagacccctggaagggctgtcccccgcattcccagtgctggcttctgttc
cgggacggacggtgtcacccgcagtgtgactctgaggagtgtctctttgatggctacgac
tgtgaaatccctctaacctgcatcccagcctatgaccagtactgccgagatcacttccac
aacgggcactgtgagaaaggctgcaataacgctgaatgtggctgggacgggggagactgc
agaccagaaggggaagactcagaggggaggccctccctggccctgctggtggtgctgagg
cccccagccctggatcagcagctgcttgccctggcacgagtgctgtccctgactctgagg
gtcggtctctgggtgaggaaggacagtgaaggcaggaacatggtgttcccctatcctggg
acccgggccaaagaggagctgagtggagctagggattcctcttcatgggaaagacaagcc
cctcccactcagcccctgggcaaggagacagagtctcttggtgcagggtttgtggtagtg
atgggagtggatctgtcccgctgtggtccggaacatcctgcgtcccgctgcccctgggac
tctggactcctgctgcgcttccttgcagcaatggcagcagtgggagctctggagcccctg
ctgcctggacccttgctggcggctcaccctcaagcagggaccaggccctctgccaaccag
cttccctggcccattctatgttcaccagtggttggggtgcttctcctggcccttggggcc
cttctcgtcctccagctcattcggcgacggcgacgagaacatggggccctgtggctgccc
cctggtttcattcgaaggcctcagacacagcaggcaccccaccggcggaggcccccactg
ggcgaggacaacattggtcttaaggcactgaagccagaggccgaagtggatgaggatgga
gtggccatgtgctcgggccctgaagagggagaggctgaagaaacagcctcagcctccagg
tgccagctttggccgctcaacagcggctgtggagagctcccccaggcagccatgctgacc
cctcctcaggagtgtgaatcggaggttctggatgtggacacctgtggacctgatggggtg
acacccctgatgtcagccgtcttctgtgggggagtgcagtccacgactggggctagtcca
cagagactggggctaggaaatctggaaccctgggaaccactgctggatagaggggcctgc
ccccaggctcacactgtgggcactggagagacgcctctgcacctagctgccagattctct
cggccaaccgctgcccgccgcctccttgaggctggagccaaccccaaccagccagaccgc
gctgggcgcaccccacttcacactgctgtggctgccgacgctcgggaggtttgccagctc
ctattggccagcagacagactacggtggacgcccgcacagaggacgggactacacctttg
atgctggctgccaggctggccgtggaggacctggttgaagaattgatcgcagcccgagca
gatgtaggagccagggataaaaggggaaaaactgcactgcactgggccgctgctgtgaac
aacgcccgagccgcccgctctctcctccaggctggagcggataaagatgcccaggacagt
agggaacagacgccgcttttcctggcagcgcgcgaaggagccgtggaggtggcgcagctg
ttgctggagctcggggcggcccggggactgcgagaccaggccgggctggccccaggagat
gtggcccgccagcgcagtcactgggacctgctaacgctgctggaaggggctggaccgact
acgcaggaggcccgtgcgcacgcacgcaccacgccggggggcggggccgcgccgcgctgc
cggacgctgtctgcgggagcgcgcccgcgcgggggcggagcctgtctgcaggctcgcact
tggtcggtggacttgggagcgcgcggagggaaggtgtatgctcgctgccggagccgatct
ggaagctgcggaggccccaccacgcgcggccgcaggttctccgcgggctcccgtggacga
cgcggggctagggcatcacaggatgactggcctcgcgactgggtggccctggaagcctgc
ggctccgcctgcagtgcgccgatcccgcctcccagcctgaccccgtccccagaacgtgga
tcccctcaagttgcctggggtcttccagttcaccaagagattcccttaaactcggttgta
agaaatctgaactag

DBGET integrated database retrieval system