KEGG   Mus musculus (mouse): 18205Help
Entry
18205             CDS       T01002                                 

Gene name
Ntf3, AI316846, AI835689, HDNF, NGF-2, Nt3, Ntf-3
Definition
(RefSeq) neurotrophin 3
  KO
K04356  neurotrophin 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18205 (Ntf3)
   04010 MAPK signaling pathway
    18205 (Ntf3)
   04151 PI3K-Akt signaling pathway
    18205 (Ntf3)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18205 (Ntf3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18205 (Ntf3)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18205 (Ntf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGF Spaetzle
Motif
Other DBs
NCBI-GeneID: 18205
NCBI-ProteinID: NP_032768
MGI: 97380
Ensembl: ENSMUSG00000049107
Vega: OTTMUSG00000056716
UniProt: P20181 Q3V1A4
LinkDB All DBs
Position
6 F3; 6 60.45 cM
AA seq 258 aa AA seqDB search
MSILFYVIFLAYLRGIQGNSMDQRSLPEDSLNSLIIKLIQADILKNKLSKQMVDVKENYQ
STLPKAEAPREPEQGEATRSEFQPMIATDTELLRQQRRYNSPRVLLSDSTPLEPPPLYLM
EDYVGNPVVANRTSPRRKRYAEHKSHRGEYSVCDSESLWVTDKSSAIDIRGHQVTVLGEI
KTGNSPVKQYFYETRCKEARPVKNGCRGIDDKHWNSQCKTSQTYVRALTSENNKLVGWRW
IRIDTSCVCALSRKIGRT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcttgttttatgtgatatttcttgcttatctccgtggcatccaaggcaacagc
atggatcaaaggagtttgccggaagactctctcaattccctcatcatcaagctgatccag
gcggatatcttgaaaaacaagctttccaaacagatggtggatgttaaggaaaattaccag
agcaccctgcccaaagcagaggcacccagggaaccagagcagggagaggccaccaggtca
gagttccagccaatgattgcaacggacacagagctactacggcaacagagacgctacaat
tcgccccgggtcctgctgagtgacagcacccctttggagccccctcccttatacctaatg
gaggattatgtgggcaacccggtggtagccaatagaacctcaccacggaggaaacgctat
gcagaacataagagtcaccgaggagagtactcagtgtgtgacagtgagagcctgtgggtg
accgacaagtcctcagccattgacattcggggacaccaggtcacagtgctgggggagatc
aaaaccggtaactctcctgtgaaacaatatttttatgaaacgagatgtaaagaagccagg
ccggtcaaaaacggttgcagggggattgatgacaaacactggaactctcagtgcaaaact
tcgcaaacctatgtccgagcactgacttcagaaaacaacaaactcgtaggctggcgctgg
atacgaatagacacttcctgtgtgtgtgccttgtcgagaaaaattggaagaacatga

DBGET integrated database retrieval system