KEGG   Mus musculus (mouse): 18211Help
Entry
18211             CDS       T01002                                 

Gene name
Ntrk1, C80751, Tkr, TrkA, trk
Definition
(RefSeq) neurotrophic tyrosine kinase, receptor, type 1
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04210  Apoptosis
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18211 (Ntrk1)
   04010 MAPK signaling pathway
    18211 (Ntrk1)
   04151 PI3K-Akt signaling pathway
    18211 (Ntrk1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18211 (Ntrk1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18211 (Ntrk1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18211 (Ntrk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18211 (Ntrk1)
   05202 Transcriptional misregulation in cancer
    18211 (Ntrk1)
   05230 Central carbon metabolism in cancer
    18211 (Ntrk1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    18211 (Ntrk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18211 (Ntrk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18211 (Ntrk1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   18211 (Ntrk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase TPKR_C2 LRR_8 I-set Ig_3 Ig_2 TrkA_TMD LRR_4 C2-set_2
Motif
Other DBs
NCBI-GeneID: 18211
NCBI-ProteinID: NP_001028296
MGI: 97383
Ensembl: ENSMUSG00000028072
Vega: OTTMUSG00000051890
UniProt: Q3UFB7
LinkDB All DBs
Position
3 F1; 3 38.62 cM
AA seq 799 aa AA seqDB search
MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGPSGLRCTRAGSLDTLR
GLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLRFVAPDAFRFTPRLSHL
NLSSNALESLSWKTVQGLSLQDLTLSGNPLHCSCALFWLQRWEQEGLCGVHTQTLHDSGP
GDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADWILTELEGAATV
KKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPASVHLGLAVEQHH
WCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHGCLRLNQPTHVNNG
NYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPVSFSPVDGNSTSRDPVEKKDETPFG
VSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHFMTLGGSSLS
PTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLAECYNLLNDQD
KMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLLMVFEYMRHGDL
NRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCL
VGQGLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVL
WEIFTYGKQPWYQLSNTEAIECITQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDV
HARLQALAQAPPSYLDVLG
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaggccagcggctcgggcagctgggctggcatcgcccggccgcggggctaggc
agtctgatgacttcgttgatgctggcctgtgcctccgccgcatcctgtcgcgaggtctgc
tgtcccgtgggcccctcggggctgcgctgcaccagggcagggtccctggataccctccgc
ggcctgcggggcgccgggaacctgacggagctctacgtggaaaaccagcagcacctgcaa
cgcttggagtttgaggacctgcagggcctgggggagttgagaagcctaaccatcgtgaag
agtggcctccgctttgtggccccagatgccttccgtttcacccctcggctcagtcacctg
aatctgtcctccaatgcgttggagtccctctcctggaaaactgtgcagggcctctcccta
caggacctgaccctgtcagggaacccactgcattgttcctgtgccctgttctggctccag
cgttgggagcaggaagggctgtgtggtgtgcatacacagacgcttcatgactctgggcct
ggagaccagttcctcccactgggacacaacaccagttgtggtgtacccacagtgaagatc
cagatgcccaatgactctgtggaagtgggcgatgacgtgtttctgcagtgccaggtggag
gggctggccctacagcaggctgactggatcctcacagagctggaaggggcagccaccgtg
aagaaatttggagatctgccatccctggggctgattctggtcaatgtcaccagtgatctc
aacaagaagaatgtgacgtgctgggcagagaatgatgtgggccgggccgaggtctctgtc
caagtcagcgtctccttcccagccagtgtgcacctgggcctagcggtggagcagcatcat
tggtgcatccccttctcggtggacgggcagccagcaccgtctctgcgctggttgttcaac
ggctctgtgctcaacgagaccagtttcatcttcactcagttcttggagtctgcgctgact
aatgagaccatgcggcacggctgcctgcgcctcaatcagcccacgcatgtcaacaacggg
aactacaccctgctggcggccaacccctacggccaggctgccgcctccgtcatggctgct
tttatggacaacccttttgagttcaaccctgaggaccccatccctgtctccttctcgcca
gtggacggtaacagcacatcaagagacccagtggagaagaaagatgaaaccccttttggg
gtctctgtggctgtgggcctagccgtctctgccgccctcttcctttctgccctccttctt
gtgctcaacaaatgtggacagaggagcaaatttgggatcaaccgccctgctgtattagct
ccagaggatgggctggccatgtccctacacttcatgacactgggtggcagttctctttcc
cctactgagggcaaaggctccggactccagggccacatcatggagaacccacagtacttc
agtgatacctgtgtccatcacatcaagcgccaggacatcattctcaagtgggagctaggg
gagggagcctttggaaaggtctttctcgctgagtgctacaaccttctgaatgatcaggac
aagatgctcgtggctgtcaaggcactgaaggaggcatccgagaatgctcggcaggacttt
cagcgtgaggccgagctgctcaccatgctacagcaccagcacatcgtgcgcttctttgga
gtctgcaccgagggtggcccgttgctcatggtctttgagtacatgcgccacggggacctc
aaccgtttcctccggtcccacggacctgatgcaaagctgctggctggtggtgaggatgtg
gctcctggtcctctgggccttgggcagcttctggctgtggctagccaggtggctgctggt
atggtatatctagccagcctgcactttgtgcaccgggatctggccacacgcaactgtctg
gtgggtcagggactagtggtgaagattggagactttggcatgagcagagacatctatagc
acagactattaccgagtgggaggtcggaccatgctgcccatccgctggatgccacccgag
agcatcctctaccgcaagttcagcaccgagagcgatgtgtggagctttggggtggtgctc
tgggagatcttcacctatggaaagcagccctggtaccagctctccaacactgaggcgatc
gagtgtatcacgcagggccgggagctggagcggccgcgcgcctgccctcctgatgtctac
gccatcatgcgaggctgctggcagcgagaaccgcagcaacgcctcagcatgaaggatgtg
cacgcgcgtctgcaggccctggcacaggcgccacccagttacctggacgttctgggctag

DBGET integrated database retrieval system