KEGG   Mus musculus (mouse): 18423Help
Entry
18423             CDS       T01002                                 

Gene name
Otx1, A730044F23Rik, jv
Definition
(RefSeq) orthodenticle homeobox 1
  KO
K09326  homeobox protein OTX1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    18423 (Otx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18423 (Otx1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    18423 (Otx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TF_Otx Homeodomain SatD
Motif
Other DBs
NCBI-GeneID: 18423
NCBI-ProteinID: NP_035153
MGI: 97450
Ensembl: ENSMUSG00000005917
Vega: OTTMUSG00000005253
UniProt: P80205 Q5SS54
LinkDB All DBs
Position
11 A3.2; 11 14.1 cM
AA seq 355 aa AA seqDB search
MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAKT
RYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGNGTKTRPVKKKSSPVRESSG
SESSGQFTPPAVSSSASSSSSASSASANPAAAAAAGLGGNPVAAASSLSTPTASSIWSPA
SISPGSAPTSVSVPEPLAAPSNASCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPAPSS
SYFGGVDCSSYLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH
HHQGYGGSGLAFNSADCLDYKEPAAAAASSAWKLNFNSPDCLDYKDQASWRFQVL
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcttacctcaaacaacccccatacggcatgaacgggctgggcctagctggccct
gccatggacctcctgcacccctccgtgggctaccctgccaccccgcggaagcagcgacgg
gagcgcaccaccttcacgcgctcacagctggacgtgctcgaggcgctgttcgcaaagact
cgctacccagacatcttcatgcgcgaggaggtggcactcaagatcaacctgccagagtcc
agagtccaggtttggttcaagaaccgccgcgccaagtgccgccagcagcagcagagcggg
aatggaacgaaaacccggccggtcaagaagaagtcgtctccagtacgcgagagctcgggt
tcagagagcagcggccagttcacgccgcccgccgtatctagctctgcttcttcgtctagc
tcagcgtccagtgcctccgccaaccccgcggctgctgcggccgcgggcctgggtgggaac
ccagtggcagcagcgtcctctctgagcacgcctactgcttcgtccatctggagcccggcc
tccatctcgccgggctcagcgccgacatccgtatcggtgccagagccactggccgctccg
agcaacgcctcgtgcatgcagcgctcggtagccgcaggtgcggccactgccgcagcctcc
taccctatgtcctatggccagggcggaagctatggtcagggataccccgcgccctcctct
tcttactttggcggtgtagactgcagctcctacctagcgcccatgcactctcatcaccac
ccgcaccagcttagccccatggcaccctcctccatggctggccatcatcaccatcaccct
catgcgcaccacccactgagccaatcttcaggccaccaccaccaccatcaccaccaccac
caccaccaaggttatggaggctctgggctcgccttcaattctgccgattgcttggattac
aaggagcccgccgccgccgctgcttcctctgcctggaaactcaatttcaactctcccgac
tgtctggactataaggaccaagcctcgtggcggttccaggtcttgtga

DBGET integrated database retrieval system