KEGG   Mus musculus (mouse): 18479Help
Entry
18479             CDS       T01002                                 

Gene name
Pak1, AW045634, PAK-1, Paka
Definition
(RefSeq) p21 (RAC1) activated kinase 1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04360  Axon guidance
mmu04392  Hippo signaling pathway - multiple species
mmu04510  Focal adhesion
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04810  Regulation of actin cytoskeleton
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18479 (Pak1)
   04010 MAPK signaling pathway
    18479 (Pak1)
   04012 ErbB signaling pathway
    18479 (Pak1)
   04392 Hippo signaling pathway - multiple species
    18479 (Pak1)
   04024 cAMP signaling pathway
    18479 (Pak1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18479 (Pak1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18479 (Pak1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18479 (Pak1)
   04650 Natural killer cell mediated cytotoxicity
    18479 (Pak1)
   04660 T cell receptor signaling pathway
    18479 (Pak1)
   04666 Fc gamma R-mediated phagocytosis
    18479 (Pak1)
   04062 Chemokine signaling pathway
    18479 (Pak1)
  09158 Development and regeneration
   04360 Axon guidance
    18479 (Pak1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    18479 (Pak1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    18479 (Pak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18479 (Pak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18479 (Pak1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18479 (Pak1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    18479 (Pak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18479 (Pak1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE20 family
   18479 (Pak1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    18479 (Pak1)
 Endocytosis
  Macropinocytosis
   Kinases
    18479 (Pak1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     18479 (Pak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Motif
Other DBs
NCBI-GeneID: 18479
NCBI-ProteinID: NP_001344291
MGI: 1339975
Ensembl: ENSMUSG00000030774
Vega: OTTMUSG00000021135
LinkDB All DBs
Position
7 E1; 7 53.57 cM
AA seq 552 aa AA seqDB search
MSNNGVDIQDKPPAPPMRNTSTMIGAGSKDTGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKSAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSFGQKDQREVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPD
ALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATG
QEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLT
DVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQ
ITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRAL
YLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPL
IAAAKEATKNNH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataacggcgtagacatccaggacaaacccccagcccctccgatgagaaacacc
agcactatgattggagccggcagcaaagacactggaaccctaaaccacggctccaaacct
ctgcctccaaacccagaggagaagaaaaagaaggaccggttttatcgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggagcgaccagagatttctcttccttcagat
tttgagcatacaattcatgttggttttgatgctgtcacaggggagtttacgggaatgcca
gaacagtgggctcgcttgcttcaaacatcaaatatcacaaagtcagaacagaagaaaaac
ccacaggctgttctggatgtgttggaattttataactctaagaagacctccaatagtcag
aagtacatgagttttacagataagtcagctgaagattataattcttctaacactttgaat
gtgaagactgtgtctgagaccccagcagtaccaccagtgtcagaagatgaagatgatgat
gacgatgctaccccacctccagtgattgctccacgcccagaacacacaaaatcttttggg
cagaaggatcagagagaggtatatacacgatctgtgattgaaccacttcctgttactcca
actcgggatgtggctacatctcctatttctcctactgagaataacaccactccgccagat
gctttgacccggaacacggaaaaacagaagaagaagcctaaaatgtctgatgaggagatc
ttagagaaattacggagcatagtgagtgtgggtgatcctaagaagaagtacacacggttc
gagaagattggacaaggtgcttcaggcacagtgtatactgcaatggatgtagccacaggg
caggaggtggccattaaacagatgaatcttcagcagcagccgaagaaagagctgattatt
aatgagatcctggtcatgagggaaaacaaaaacccaaatattgtcaactacctggacagt
taccttgtgggagatgagctgtgggttgttatggaatacttggctggaggctccttgaca
gatgtggtgacagaaacctgtatggatgaaggccagatagcagctgtgtgccgagagtgt
ctacaagctttggagtttctacattcaaaccaagtcattcacagggacatcaagagtgac
aatattctgctgggaatggatggctctgtcaagttaactgactttggattctgtgcacag
ataactccagagcagagcaaaaggagcaccatggtgggaactccatattggatggcacct
gaagttgtgacacgcaaggcctatggacccaaggttgacatctggtccctgggcattatg
gcaattgaaatgattgagggggagcccccatacctcaatgaaaaccctttgagagccttg
tacctcattgctaccaatgggacgccagagcttcagaacccagagaagttgtcagctatt
ttccgggacttcctgaaccgctgtcttgagatggatgtggagaagagaggctcagctaaa
gagctgctgcagcatcagttcctgaagattgccaagcccctctctagcctgactccactg
attgctgcagcaaaagaggcaaccaagaacaatcactga

DBGET integrated database retrieval system