KEGG   Mus musculus (mouse): 18510Help
Entry
18510             CDS       T01002                                 

Gene name
Pax8, Pax-8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04918  Thyroid hormone synthesis
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    18510 (Pax8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18510 (Pax8)
   05202 Transcriptional misregulation in cancer
    18510 (Pax8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    18510 (Pax8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18510 (Pax8)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    18510 (Pax8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 18510
NCBI-ProteinID: NP_035170
MGI: 97492
Ensembl: ENSMUSG00000026976
Vega: OTTMUSG00000011957
UniProt: Q00288
LinkDB All DBs
Position
2 A3; 2 16.43 cM
AA seq 457 aa AA seqDB search
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSK
ILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDND
TVPSVSSINRIIRTKVQQPFNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTY
SINGLLGIAQPGNDNKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDTFSQHHLEALECP
FERQHYPEAYASPSHTKGEQGLYPLPLLNSALDDGKATLTSSNTPLGRNLSTHQTYPVVA
DPHSPFAIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVPPFNAFPHAASVYG
QFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYSHTPYSSY
SEAWRFPNSSLLSSPYYYSSTSRPSAPPTSATAFDHL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacaactcgatcagatccggccatggagggctgaatcaactaggaggggccttt
gtgaatggcaggcctctgccagaagttgtacgtcaacgcattgtggacttggcccaccag
ggcgtgaggccctgtgatatttctcgccagctccgtgtcagccatggctgtgtaagcaag
atccttggcaggtactacgagactggcagcatccggcctggagtgatagggggctccaag
cccaaggtggccacccccaaggtggtggagaagataggagactacaagcggcagaaccct
accatgtttgcttgggagatccgggaccggctcctggcagaaggcgtttgtgacaatgac
actgtccccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcagccattc
aacctccccatggatagctgtgtggccaccaagtctctgagcccaggacacacactgatc
cccagctcagctgtaacacccccagagtcaccccagtcggattccttgggctctacctac
tctatcaacgggctcctaggaattgctcagcctggcaatgacaacaagagaaagatggat
gatagtgaccaggacagctgtcggctaagcatcgactcacagagcagcagcagtggtcct
cgaaagcaccttcgtacggacaccttcagccagcaccatctcgaggcccttgagtgcccg
tttgagcggcagcattacccggaggcctatgcctcccccagccacaccaaaggggagcag
gggctgtacccactgcccttactcaacagtgccctggatgatgggaaggccaccctgaca
tcttccaatacacctctgggacgcaacctctcgactcaccagacctaccctgtggtggca
gatcctcattcacccttcgccataaagcaggaaaccccagagctctccagttctagctcc
accccttcctctttatctagctccgcctttttggatctgcagcaagtcggctctgggggc
ccagcaggtgcctcggtcccacccttcaatgcctttccccatgctgcctccgtgtatggg
cagttcacgggccaggccctcctctcagggcgagagatggtggggcccacgctgcctgga
tacccaccccacatccccaccagtggacagggcagctatgcctcttctgctatcgcaggc
atggtggcaggaagtgaatattctggcaatgcctacagccacaccccgtattcctcctac
agtgaggcctggcgcttccccaactccagcctgctgagttctccatattattacagctct
acatcaaggccaagcgcaccacccacctctgccacagcctttgaccatctgtag

KEGG   Mus musculus (mouse): 19016Help
Entry
19016             CDS       T01002                                 

Gene name
Pparg, Nr1c3, PPAR-gamma, PPAR-gamma2, PPARgamma, PPARgamma2
Definition
(RefSeq) peroxisome proliferator activated receptor gamma
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04380  Osteoclast differentiation
mmu04714  Thermogenesis
mmu05016  Huntington disease
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    19016 (Pparg)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    19016 (Pparg)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19016 (Pparg)
  09149 Aging
   04211 Longevity regulating pathway
    19016 (Pparg)
  09159 Environmental adaptation
   04714 Thermogenesis
    19016 (Pparg)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19016 (Pparg)
   05202 Transcriptional misregulation in cancer
    19016 (Pparg)
  09162 Cancer: specific types
   05216 Thyroid cancer
    19016 (Pparg)
  09164 Neurodegenerative disease
   05016 Huntington disease
    19016 (Pparg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19016 (Pparg)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19016 (Pparg)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    19016 (Pparg)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   19016 (Pparg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Motif
Other DBs
NCBI-GeneID: 19016
NCBI-ProteinID: NP_035276
MGI: 97747
Ensembl: ENSMUSG00000000440
Vega: OTTMUSG00000056643
UniProt: P37238 M1VPI1 Q6GU14
LinkDB All DBs
Position
6 E3; 6 53.41 cM
AA seq 505 aa AA seqDB search
MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGISSVDLSVMEDHSHSF
DIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQSAIKVEPASPPYYSEKT
QLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKVLQKMTDLRQIVTEHVQL
LHVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaaactctgggagattctcctgttgacccagagcatggtgccttcgctgatgca
ctgcctatgagcacttcacaagaaattaccatggttgacacagagatgccattctggccc
accaacttcggaatcagctctgtggacctctccgtgatggaagaccactcgcattccttt
gacatcaagccctttaccacagttgatttctccagcatttctgctccacactatgaagac
attccattcacaagagctgacccaatggttgctgattacaaatatgacctgaagctccaa
gaataccaaagtgcgatcaaagtagaacctgcatctccaccttattattctgaaaagacc
cagctctacaacaggcctcatgaagaaccttctaactccctcatggccattgagtgccga
gtctgtggggataaagcatcaggcttccactatggagttcatgcttgtgaaggatgcaag
ggttttttccgaagaaccatccgattgaagcttatttatgataggtgtgatcttaactgc
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaagtgccttgct
gtggggatgtctcacaatgccatcaggtttgggcggatgccacaggccgagaaggagaag
ctgttggcggagatctccagtgatatcgaccagctgaacccagagtctgctgatctgcga
gccctggcaaagcatttgtatgactcatacataaagtccttcccgctgaccaaagccaag
gcgagggcgatcttgacaggaaagacaacggacaaatcaccatttgtcatctacgacatg
aattccttaatgatgggagaagataaaatcaagttcaaacatatcacccccctgcaggag
cagagcaaagaggtggccatccgaatttttcaagggtgccagtttcgatccgtagaagcc
gtgcaagagatcacagagtatgccaaaaatatccctggtttcattaaccttgatttgaat
gaccaagtgactctgctcaagtatggtgtccatgagatcatctacacgatgctggcctcc
ctgatgaataaagatggagtcctcatctcagagggccaaggattcatgaccagggagttc
ctcaaaagcctgcggaagccctttggtgactttatggagcctaagtttgagtttgctgtg
aagttcaatgcactggaattagatgacagtgacttggctatatttatagctgtcattatt
ctcagtggagaccgcccaggcttgctgaacgtgaagcccatcgaggacatccaagacaac
ctgctgcaggccctggaactgcagctcaagctgaatcacccagagtcctctcagctgttc
gccaaggtgctccagaagatgacagacctcaggcagatcgtcacagagcacgtgcagcta
ctgcatgtgatcaagaagacagagacagacatgagccttcaccccctgctccaggagatc
tacaaggacttgtattag

DBGET integrated database retrieval system