KEGG   Mus musculus (mouse): 18590Help
Entry
18590             CDS       T01002                                 

Gene name
Pdgfa, PDGF-1
Definition
(RefSeq) platelet derived growth factor, alpha
  KO
K04359  platelet-derived growth factor subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  Jak-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18590 (Pdgfa)
   04015 Rap1 signaling pathway
    18590 (Pdgfa)
   04010 MAPK signaling pathway
    18590 (Pdgfa)
   04630 Jak-STAT signaling pathway
    18590 (Pdgfa)
   04072 Phospholipase D signaling pathway
    18590 (Pdgfa)
   04151 PI3K-Akt signaling pathway
    18590 (Pdgfa)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18590 (Pdgfa)
   04540 Gap junction
    18590 (Pdgfa)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18590 (Pdgfa)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18590 (Pdgfa)
   05202 Transcriptional misregulation in cancer
    18590 (Pdgfa)
   05206 MicroRNAs in cancer
    18590 (Pdgfa)
   05231 Choline metabolism in cancer
    18590 (Pdgfa)
  09162 Cancer: specific types
   05214 Glioma
    18590 (Pdgfa)
   05218 Melanoma
    18590 (Pdgfa)
   05215 Prostate cancer
    18590 (Pdgfa)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18590 (Pdgfa)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18590 (Pdgfa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18590 (Pdgfa)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18590 (Pdgfa)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18590 (Pdgfa)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   18590 (Pdgfa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF_N PDGF
Motif
Other DBs
NCBI-GeneID: 18590
NCBI-ProteinID: NP_032834
MGI: 97527
Ensembl: ENSMUSG00000025856
Vega: OTTMUSG00000025151
UniProt: P20033 Q99L56
LinkDB All DBs
Position
5 G2; 5 77.65 cM
AA seq 196 aa AA seqDB search
MRTWACLLLLGCGYLAHALAEEAEIPRELIERLARSQIHSIRDLQRLLEIDSVGAEDALE
TSLRAHGSHAINHVPEKRPVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACA
TSNLNPDHREEETDVR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaggacctgggcttgcctgctgctcctcggctgcggatacctcgcccatgccctggcc
gaggaagccgagataccccgggagttgatcgagcggctggctcgaagtcagatccacagc
atccgggacctccagcgactcttggagatagactccgtaggggctgaggatgccttggag
acaagtctgagagcccatgggtcccatgccattaaccatgtgcccgagaagcggcctgtg
cccattcgcaggaagagaagtattgaggaagccattcctgcagtttgcaagaccaggacg
gtcatttacgagatacctcggagccaggtggaccccacatcggccaacttcctgatctgg
cccccatgtgtggaggtgaagcgctgcactggctgttgtaacaccagcagcgtcaagtgc
cagccttcacgggtccaccaccgcagtgtcaaggtggccaaagtggagtatgtcaggaag
aagccaaaattgaaagaggtccaggtgaggttagaggaacacctggagtgtgcatgtgcg
acctccaacctgaacccagaccatcgggaggaggagacagatgtgaggtga

KEGG   Mus musculus (mouse): 18591Help
Entry
18591             CDS       T01002                                 

Gene name
Pdgfb, PDGF-2, PDGF-B, Sis, c-sis
Definition
(RefSeq) platelet derived growth factor, B polypeptide
  KO
K17386  platelet-derived growth factor subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  Jak-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05211  Renal cell carcinoma
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05231  Choline metabolism in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18591 (Pdgfb)
   04015 Rap1 signaling pathway
    18591 (Pdgfb)
   04010 MAPK signaling pathway
    18591 (Pdgfb)
   04630 Jak-STAT signaling pathway
    18591 (Pdgfb)
   04072 Phospholipase D signaling pathway
    18591 (Pdgfb)
   04151 PI3K-Akt signaling pathway
    18591 (Pdgfb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18591 (Pdgfb)
   04540 Gap junction
    18591 (Pdgfb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18591 (Pdgfb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18591 (Pdgfb)
   05206 MicroRNAs in cancer
    18591 (Pdgfb)
   05231 Choline metabolism in cancer
    18591 (Pdgfb)
  09162 Cancer: specific types
   05214 Glioma
    18591 (Pdgfb)
   05218 Melanoma
    18591 (Pdgfb)
   05211 Renal cell carcinoma
    18591 (Pdgfb)
   05215 Prostate cancer
    18591 (Pdgfb)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18591 (Pdgfb)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    18591 (Pdgfb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18591 (Pdgfb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18591 (Pdgfb)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18591 (Pdgfb)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   18591 (Pdgfb)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors
   18591 (Pdgfb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF PDGF_N
Motif
Other DBs
NCBI-GeneID: 18591
NCBI-ProteinID: NP_035187
MGI: 97528
Ensembl: ENSMUSG00000000489
UniProt: P31240 A0A0R4IZW4
LinkDB All DBs
Position
15 E1; 15 37.85 cM
AA seq 241 aa AA seqDB search
MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHRDSVDEDGAEL
DLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGKHRKFKHTHDKAALKETLG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttccttcctctctgctgctacctgcgtctggtcagcgcc
gagggggatcccattcctgaggaactgtatgaaatgctgagcgaccactccatccgctcc
tttgatgatcttcagcgcctgctgcacagagactccgtagatgaagatggggctgagctg
gacttgaacatgacccgagcacactccggagtcgagttggaaagctcatctcgagggagg
aggagcctagggtccctggcagcagcagagcctgctgtaatcgccgagtgcaagacgcgc
acagaggtgttccagatctctcggaacctcatcgatcgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaataaccgcaatgtgcaa
tgccgggcctcgcaggtgcagatgcggccggtccaggtgagaaagattgagattgtgcga
aagaagcccatcttcaagaaggccacagtgaccttggaggaccacctcgcctgcaagtgt
gagacagtagtgacccctcggcctgtgactagaagtcctgggacatccagggagcagcga
gccaagacgcctcaagctcgggtgaccattcggacggtgagaatccgccggccccccaaa
ggcaagcaccgaaagtttaagcacacccatgacaaggcggccctgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system