KEGG   Mus musculus (mouse): 18595
Entry
18595             CDS       T01002                                 

Gene name
Pdgfra, AI115593, CD140, CD140a, Pdgfr, Pdgfr-2
Definition
(RefSeq) platelet derived growth factor receptor, alpha polypeptide
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04630  JAK-STAT signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05230  Central carbon metabolism in cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18595 (Pdgfra)
   04014 Ras signaling pathway
    18595 (Pdgfra)
   04015 Rap1 signaling pathway
    18595 (Pdgfra)
   04630 JAK-STAT signaling pathway
    18595 (Pdgfra)
   04020 Calcium signaling pathway
    18595 (Pdgfra)
   04072 Phospholipase D signaling pathway
    18595 (Pdgfra)
   04151 PI3K-Akt signaling pathway
    18595 (Pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18595 (Pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18595 (Pdgfra)
   04540 Gap junction
    18595 (Pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    18595 (Pdgfra)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18595 (Pdgfra)
   05206 MicroRNAs in cancer
    18595 (Pdgfra)
   05230 Central carbon metabolism in cancer
    18595 (Pdgfra)
   05231 Choline metabolism in cancer
    18595 (Pdgfra)
  09162 Cancer: specific types
   05214 Glioma
    18595 (Pdgfra)
   05218 Melanoma
    18595 (Pdgfra)
   05215 Prostate cancer
    18595 (Pdgfra)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18595 (Pdgfra)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18595 (Pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18595 (Pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    18595 (Pdgfra)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     18595 (Pdgfra)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   18595 (Pdgfra)
CD molecules [BR:mmu04090]
 Proteins
  18595 (Pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 C1-set DUF3475 LAT Kinase-like
Other DBs
NCBI-GeneID: 18595
NCBI-ProteinID: NP_001076785
MGI: 97530
Ensembl: ENSMUSG00000029231
Vega: OTTMUSG00000056081
UniProt: P26618
LinkDB
Position
5 C3.3; 5 39.55 cM
AA seq 1089 aa
MGTSHQVFLVLSCLLTGPGLISCQLLLPSILPNENEKIVQLNSSFSLRCVGESEVSWQHP
MSEEDDPNVEIRSEENNSGLFVTVLEVVNASAAHTGWYTCYYNHTQTDESEIEGRHIYIY
VPDPDMAFVPLGMTDSLVIVEEDDSAIIPCRTTDPETQVTLHNNGRLVPASYDSRQGFNG
TFSVGPYICEATVKGRTFKTSEFNVYALKATSELNLEMDARQTVYKAGETIVVTCAVFNN
EVVDLQWTYPGEVRNKGITMLEEIKLPSIKLVYTLTVPKATVKDSGEYECAARQATKEVK
EMKRVTISVHEKGFVEIEPTFGQLEAVNLHEVREFVVEVQAYPTPRISWLKDNLTLIENL
TEITTDVQKSQETRYQSKLKLIRAKEEDSGHYTIIVQNEDDVKSYTFELSTLVPASILDL
VDDHHGSGGGQTVRCTAEGTPLPEIDWMICKHIKKCNNDTSWTVLASNVSNIITELPRRG
RSTVEGRVSFAKVEETIAVRCLAKNNLSVVARELKLVAPTLRSELTVAAAVLVLLVIVIV
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFMSQHPEKPKKDLDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDDSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVQCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacctcccaccaggtctttctggtcctcagctgtctcctcacagggccgggcctc
atctcctgccagctcttattaccctctatcctcccaaacgagaatgagaagattgtgcag
ctgaattcgtccttttctctgagatgcgttggggagagtgaagtgagctggcagcacccc
atgtctgaagaagacgaccccaacgtggaaatcagaagtgaggagaacaacagtggcctc
tttgtcacagtgctggaagtggttaacgcctccgcagcccacaccggatggtacacttgc
tactacaaccacactcagacggatgagagtgagatcgaaggcaggcacatttacatctat
gtaccagacccagacatggcctttgtgcctctcgggatgaccgattccttagtcatcgtg
gaagaggatgactctgccatcataccttgccgcaccacagatccggagactcaagtaacc
ttgcacaataacgggaggctggtgcctgcctcctatgacagcaggcagggcttcaacgga
accttcagcgtggggccttacatctgtgaggccaccgtcaaagggaggacgttcaagacc
agcgagtttaatgtttatgccttgaaagcaacgtcagaactgaatctggagatggacgca
cgccagactgtgtataaggcaggagaaacgatcgtggtgacctgtgccgtctttaacaac
gaggtcgttgacctgcagtggacttaccctggagaagtgagaaacaaaggtatcaccatg
ctggaggagatcaaactcccatccatcaaactggtgtacactttgaccgtccccaaggcc
acggtgaaggacagtggagagtatgaatgtgctgcccgtcaggccactaaagaggtcaag
gaaatgaagagagtcaccatttctgtccacgagaaaggcttcgtcgagattgagcccacc
tttggccagctggaagctgtcaacttgcacgaagtcagagagttcgtggtggaggtgcag
gcctacccgacgcccaggatatcgtggctgaaggacaacttgactctgatagagaatctc
accgagatcaccactgatgtacagaagagtcaggaaacaaggtatcagagcaaattaaag
ctgatccgggctaaggaagaagacagtggccattacaccattatagttcaaaatgaggat
gacgtgaagagttacacgtttgagctgtcaaccctagttcctgcatccattttggatctc
gtagatgaccaccatggctctggcgggggacagactgtgaggtgtacagccgaaggcacc
cctcttccagaaatcgactggatgatctgcaagcatattaagaaatgtaataatgacact
tcgtggacagttttggccagcaatgtctcaaatattatcacagagctccctcgccgtggc
aggagtaccgtggagggacgagtgtccttcgccaaagtggaagagaccatcgcagttcga
tgcctggcaaagaacaacctcagcgttgtggcccgtgagctgaagctggtggctcccact
ctgcgatctgaactcacagtggcggccgcagtgttggtgctgttggtgattgtcattgtc
tctctcatcgtcctggtggtcatttggaagcagaaaccacggtatgaaattcgctggagg
gttatcgagtcaatcagccccgatggacatgagtatatctatgtggaccccatgcagttg
ccttacgactccagatgggaattcccgagagatggcctcgtgcttggtcggattttggga
tccggtgcatttgggaaagtggtcgaaggtacagcttatggattaagccggtcccaacct
gtaatgaaggtggctgtgaagatgctcaaacccacagccaggtctagtgaaaagcaggct
ctcatgtctgagctgaagataatgactcacctggggccacatttgaacattgtgaacttg
ctgggagcctgcaccaagtcaggtcccatttacatcatcacagaatactgcttctatggg
gatttggtcaactacttgcataagaacagagatagcttcatgagccaacacccagagaag
ccgaagaaagacctggacatctttggattgaatcctgcagacgagagcacaagaagttat
gtgattttgtcttttgaaaataacggcgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgcttgaaaggaaagaggtttctaaatactctgacatccagagatcg
ctgtacgatcggccagcctcctacaagaagaaatccatgctagactcagaagtcaaaaac
ctcctttcggacgatgactccgagggtctgactttgctggatctattgagcttcacctat
caagttgctcgaggaatggaatttttggcttcgaaaaattgtgtccaccgggacctggct
gcccgcaacgtcctcctggcgcaaggaaaaattgtgaagatctgtgattttggcctggcc
agagacatcatgcacgattccaactacgtgtcaaaaggcagtactttcctgcctgtgaag
tggatggcacccgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtcc
tatggcattctgctctgggaaatcttttcccttggtggcacaccctatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccggatggccaaacctgaccat
gccaccagtgaagtctatgagatcatggtgcagtgctggaacagtgagcccgagaagaga
ccctccttctaccacctcagcgagatagtggagaacctgttgccgggacaatacaagaag
agttatgaaaagattcacctggacttcctaaagagtgaccatccggccgtggcacgcatg
cgggtggactctgataatgcgtacatcggtgtcacttacaaaaatgaagaggataagctg
aaggactgggaaggtggcctggacgaacagagactgagcgctgacagtggctacatcatc
cccctgccagacattgaccctgttccagaggaggaagacctgggcaagaggaacagacac
agctcacagacttcggaagagagtgccatcgagacaggttccagtagttccaccttcatc
aagagagaggacgagaccatcgaggacatcgacatgatggatgacattggtatagattcc
tcggacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system