KEGG   Mus musculus (mouse): 18641Help
Entry
18641             CDS       T01002                                 

Gene name
Pfkl, AA407869, ATP-PFK, PFK-B, PFK-L
Definition
(RefSeq) phosphofructokinase, liver, B-type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00030  Pentose phosphate pathway
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
mmu03018  RNA degradation
mmu04066  HIF-1 signaling pathway
mmu04152  AMPK signaling pathway
mmu04922  Glucagon signaling pathway
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18641 (Pfkl)
   00030 Pentose phosphate pathway
    18641 (Pfkl)
   00051 Fructose and mannose metabolism
    18641 (Pfkl)
   00052 Galactose metabolism
    18641 (Pfkl)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18641 (Pfkl)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    18641 (Pfkl)
   04152 AMPK signaling pathway
    18641 (Pfkl)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    18641 (Pfkl)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    18641 (Pfkl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    18641 (Pfkl)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18641 (Pfkl)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     18641 (Pfkl)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18641 (Pfkl)
Messenger RNA biogenesis [BR:mmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     18641 (Pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 18641
NCBI-ProteinID: NP_032852
MGI: 97547
Ensembl: ENSMUSG00000020277
Vega: OTTMUSG00000016976
UniProt: P12382
LinkDB All DBs
Position
10 C1; 10 39.72 cM
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLTIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
AMDEERFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYIVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWVSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
PVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtggacctggagaaactgcggatgtcgggggctggcaaggccattggagtg
ctgaccagcggcggtgatgcgcaaggtatgaatgctgctgtcagggctgtgacccgtatg
ggcatatatgtgggggccaaagtcttcctcatctatgagggctacgagggccttgtggaa
ggaggcgagaacatcaagccagccaactggctcagcgtttccaatatcatccagctgggt
ggcaccattattggcagtgcccgctgtaaggccttcactacgagggaaggccgcctggct
gcagcctacaatctgctccaacacggcatcaccaacctgtgtgtcatcggtggcgacggc
agcctcacgggggccaacatcttccgcaacgagtggggcagcttgctggaggagctggtg
aaggaaggcaagatctcagagtccacagctcagaactacgcacacttgaccatcgccggt
ctggtgggctccatcgataacgacttctgtggcactgacatgaccattggcacagactca
gccctgcaccgcattatggaggtcattgacgccatcactaccactgcccaaagtcaccag
aggacctttgttttggaggtgatgggacggcactgcgggtacctggcgctggtgtctgcc
ctggcttccggggctgattggctattcattcctgaagcgccccctgaggatggctgggag
aacttcatgtgtgagaggctgggcgagactcggagccgaggctctcggctgaacatcatc
atcatcgcagagggtgccattgaccggcatggaaagcctatctcatccagctacgtgaag
gatctggtggttcagaggctgggcttcgatacacgagtgactgtgctgggtcatgtacag
cgaggagggacgccttcagccttcgaccgaatcctgagtagcaagatgggtatggaggcc
gtgatggcgctgctagaggccacgcctgacacgccggcctgtgtggtcagcctctccggg
aaccagtctgtgaggctacctctcatggagtgtgtgcaagtgacaaaggacgtgcagaag
gccatggacgaggagaggtttgacgaggccatccagctccgtggcaggagctttgagaac
aactggaaaatttacaagctccttgcccaccagaaggtgtctaaagagaagtccaacttc
tccctggccatcctgaatgtgggggctccagctgctggcatgaatgcagctgtgcgctcc
gcagtgcgcactggtatctccgagggacacacggtatacatcgtgcatgatggctttgag
ggtctggccaagggtcaggtgcaagaagtgggctggcatgatgtggcaggctggctggga
cgtggtggctcgatgctggggaccaagaggacactgcccaagccccacctggaggccatt
gtggagaatctccgcacctacaacatccacgccctgctggtgattggtggctttgaggcc
tacgagggtgtgctgcagctggtggaggcccgggggcgctacgaggaactctgcattgtc
atgtgtgtcatcccagccaccatcagcaacaatgtgcctggcactgacttcagcctgggc
tcagacacggctgtcaacgctgcaatggagagttgtgatcgcatcaagcagtcagcctca
gggacaaagcggcgtgtgttcattgtagagaccatggggggctactgtggctacctggct
actgtgaccggcattgctgtgggtgccgatgctgcctacgtctttgaggaccctttcaac
atccatgacttaaaggccaatgtggagcatatgacagagaagatgaagacagacatccag
aggggactggtgctccggaacgagaagtgtcacgaacactacaccacagagttcctatac
aacctgtactcctcagaaggcaggggcgtgtttgactgcaggaccaatgtgctgggccac
ttgcagcagggtggtgctccaacccctttcgaccggaactatgggaccaaactgggggtg
aaggccatgttgtgggtgtctgagaagctacgtgatgtctaccgtaaagggcgggtgttt
gccaatgctccagactcagcctgtgtgatcggcctgcggaagaaggtagtggccttcagt
ccggtcacagaactcaagaaagagactgattttgagcaccgcatgccccgggagcagtgg
tggctgaatctgcggctgatgctgaagatgctggcacactaccgcatcagcatggcagac
tatgtgtctggggagctggagcacgtcacacgccgcaccttgagcatagacaagggtttc
tga

DBGET integrated database retrieval system