KEGG   Mus musculus (mouse): 18642Help
Entry
18642             CDS       T01002                                 

Gene name
Pfkm, AI131669, ATP-PFK, PFK-A, PFK-M, Pfk-4, Pfk4, Pfka, Pfkx
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00030  Pentose phosphate pathway
mmu00051  Fructose and mannose metabolism
mmu00052  Galactose metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
mmu03018  RNA degradation
mmu04152  AMPK signaling pathway
mmu05230  Central carbon metabolism in cancer
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    18642 (Pfkm)
   00030 Pentose phosphate pathway
    18642 (Pfkm)
   00051 Fructose and mannose metabolism
    18642 (Pfkm)
   00052 Galactose metabolism
    18642 (Pfkm)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    18642 (Pfkm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    18642 (Pfkm)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    18642 (Pfkm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    18642 (Pfkm)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    18642 (Pfkm)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     18642 (Pfkm)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     18642 (Pfkm)
Messenger RNA biogenesis [BR:mmu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     18642 (Pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 18642
NCBI-ProteinID: NP_001156959
MGI: 97548
Ensembl: ENSMUSG00000033065
UniProt: P47857
LinkDB All DBs
Position
15; 15 F1
AA seq 780 aa AA seqDB search
MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGEHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKDGKITAEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIVEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
EHLCRRLSETRTRGSRLNIIIVAEGAIDKNGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKRFDEAIKLRGRSFMNNWEVYKLLAHVRPPVSKGGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKNLEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSI
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISRKRSGEAAV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcatcatgcagccaaaaccctggggatcggcaaggccatcgccgtg
ttgacctctggtggagatgcccaaggtatgaatgctgccgtcagggctgtggtccgagtt
ggtatcttcacgggcgcccgcgtcttctttgtccatgagggttaccaaggcctggtggac
ggtggcgagcacatcagggaggccacgtgggagagcgtgtctatgatgcttcagctgggt
ggcacagtgattggaagtgcccgatgcaaggacttccgagagcgagaaggacgactccgg
gccgcccacaacctggtgaagcgggggatcaccaatctgtgtgtcatcggaggcgatggc
agcctcactggggctgacactttccgttcagagtggagcgacttgctgaatgatctccag
aaagacgggaagatcacagccgaggaggctacaaagtccagctacctgaacatcgtgggc
ctggttggctcaatcgacaatgacttctgtggcactgatatgaccattggtaccgactct
gccctgcacaggattgtggagatcgtagacgccatcaccaccacggctcagagccaccag
aggacgtttgtgttagaagtgatgggccgccactgtggatacctggcccttgtcacctct
ctgtcctgtggggccgactgggtttttattcctgagtgtccgccagacgatgactgggaa
gaacacctttgtcgccggctcagtgagacaaggacccgtggctctcgtctcaacatcatc
attgttgctgaaggtgccatcgacaagaacgggaagccaatcacctcagaagacatcaag
aacctggtggtgaagcgccttggatatgacacccgggtcactgttctgggacatgtacag
cggggtgggacaccatcagcctttgaccggatcctgggcagcaggatgggtgtggaagca
gtgatggcacttttggaggggaccccagacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgtttgcccctcatggagtgcgtgcaggtgaccaaagacgtgaccaag
gctatggatgagaagagatttgatgaagccattaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctagctcatgtcagacccccagtctctaagggtgggttg
cacacagtggccgtgatgaatgtgggggccccagctgctggcatgaatgccgctgttcgc
tctaccgtgaggattggccttatccagggcaaccgggtgctggtcgtacatgatggcttt
gagggtctggccaaaggtcagattgaggaggctggctggagctatgttggaggctggact
ggtcaaggtggttccaaacttggtactaaaaggactctccccaagaagaacctggaacag
atcagtgccaacataaccaagtttaacatccagggccttgtcatcattgggggctttgag
gcttacacagggggcttggagctgatggaaggcaggaagcagtttgatgagctctgcatc
ccgtttgtggtcattccggccacggtttccaataacgtccctgggtcagacttcagcatc
ggggctgacacagcactgaacaccatctgcacgacttgtgaccgaatcaagcagtctgca
gcaggcaccaaacgtcgggtgtttatcatcgagactatgggtggctactgtggctacctg
gccaccatggcagggctggccgctggggctgatgctgcctacatttttgaggaacccttc
accattcgcgatctccaggtgaatgttgaacatctggtgcagaagatgaaaacaactgtg
aagagaggcctggtgctgaggaatgagaaatgcaatgagaactacactactgacttcatt
ttcaacctgtactctgaggaggggaagggcatctttgatagcaggaagaacgtgcttggc
cacatgcagcagggtggaagcccaactccctttgacaggaattttgccactaagatgggt
gctaaggctatgaactggatgtctgggaaaatcaaggagagttaccgtaatggacggatc
tttgccaacacccctgactcaggctgcgttctggggatgcgtaagagggccctggtcttt
cagccagtaactgagctgaaggaccagacagactttgaacaccgaatccccaaagaacag
tggtggctgaagctgaggccaatcctcaaaatcctagccaagtacgagattgatctggac
acctccgaccacgcccacctggagcacatttcaaggaaacggtctggagaagccgccgtc
tag

DBGET integrated database retrieval system