KEGG   Mus musculus (mouse): 18669
Entry
18669             CDS       T01002                                 

Gene name
Abcb1b, Abcb, Abcb1, Mdr1, Mdr1b, Pgy, Pgy-, Pgy-1, Pgy1, md, mdr
Definition
(RefSeq) ATP-binding cassette, sub-family B (MDR/TAP), member 1B
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04976  Bile secretion
mmu05206  MicroRNAs in cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    18669 (Abcb1b)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    18669 (Abcb1b)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    18669 (Abcb1b)
  09162 Cancer: specific types
   05226 Gastric cancer
    18669 (Abcb1b)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18669 (Abcb1b)
   04147 Exosome [BR:mmu04147]
    18669 (Abcb1b)
   04090 CD molecules [BR:mmu04090]
    18669 (Abcb1b)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     18669 (Abcb1b)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    18669 (Abcb1b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18669 (Abcb1b)
CD molecules [BR:mmu04090]
 Proteins
  18669 (Abcb1b)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 Zeta_toxin G-alpha RsgA_GTPase AAA AAA_5 AAA_29 AAA_7 APS_kinase AAA_14 AAA_30 PRK DUF815 AAA_15 NTPase_1
Other DBs
NCBI-GeneID: 18669
NCBI-ProteinID: NP_035205
MGI: 97568
Ensembl: ENSMUSG00000028970
Vega: OTTMUSG00000054347
UniProt: P06795 B2RUR3
LinkDB
Position
5 A1; 5 3.43 cM
AA seq 1276 aa
MEFEENLKGRADKNFSKMGKKSKKEKKEKKPAVGVFGMFRYADWLDKLCMILGTLAAIIH
GTLLPLLMLVFGNMTDSFTKAEASILPSITNQSGPNSTLIISNSSLEEEMAIYAYYYTGI
GAGVLIVAYIQVSLWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSK
INDGIGDKIGMFFQSITTFLAGFIIGFISGWKLTLVILAVSPLIGLSSALWAKVLTSFTN
KELQAYAKAGAVAEEVLAAIRTVIAFGGQQKELERYNKNLEEAKNVGIKKAITASISIGI
AYLLVYASYALAFWYGTSLVLSNEYSIGEVLTVFFSILLGTFSIGHLAPNIEAFANARGA
AFEIFKIIDNEPSIDSFSTKGYKPDSIMGNLEFKNVHFNYPSRSEVQILKGLNLKVKSGQ
TVALVGNSGCGKSTTVQLMQRLYDPLEGVVSIDGQDIRTINVRYLREIIGVVSQEPVLFA
TTIAENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAI
ARALVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGF
DGGVIVEQGNHDELMREKGIYFKLVMTQTRGNEIEPGNNAYGSQSDTDASELTSEESKSP
LIRRSIYRSVHRKQDQERRLSMKEAVDEDVPLVSFWRILNLNLSEWPYLLVGVLCAVING
CIQPVFAIVFSRIVGVFSRDDDHETKRQNCNLFSLFFLVMGLISFVTYFFQGFTFGKAGE
ILTKRVRYMVFKSMLRQDISWFDDHKNSTGSLTTRLASDASSVKGAMGARLAVVTQNVAN
LGTGVILSLVYGWQLTLLLVVIIPLIVLGGIIEMKLLSGQALKDKKQLEISGKIATEAIE
NFRTIVSLTREQKFETMYAQSLQVPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAY
LVAQQLMTFENVMLVFSAVVFGAMAAGNTSSFAPDYAKAKVSASHIIRIIEKTPEIDSYS
TEGLKPTLLEGNVKFNGVQFNYPTRPNIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQL
LERFYDPMAGSVFLDGKEIKQLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRAVSH
EEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEA
TSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIENGKVKEHGTHQQLLA
QKGIYFSMVQAGAKRS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggagtttgaagagaaccttaagggaagagcagacaagaacttctcgaagatgggcaaa
aagagtaaaaaggagaagaaagaaaagaaacctgctgttggcgtatttgggatgtttcgc
tatgcagattggctggacaagctgtgcatgattctgggaactctcgctgctattatccat
ggaacattacttcccctcttgatgctggtgtttggaaacatgacagatagttttacaaaa
gcagaagccagtattctgccaagcattactaatcaaagtggacccaacagtactctgatc
atcagcaacagcagtctggaggaagagatggccatatacgcctactattacaccgggatt
ggtgctggtgtgctcatagttgcctacatccaggtttcactttggtgcctggcagctgga
agacagatacacaagattaggcagaagtttttccatgctataatgaatcaggagataggc
tggtttgatgtgcatgatgttggggagctcaacacccggctcacagatgatgtctccaaa
attaatgacggaattggtgacaaaattgggatgttttttcagtccataaccacattttta
gccggttttatcataggatttataagtggttggaagctaacccttgtcattttggctgtc
agccctcttattggattgtcatctgctttgtgggcaaaggtattgacttcatttactaat
aaggaactccaggcttatgcaaaagctggagcagttgctgaagaagtcttagcagccatc
agaactgtgattgcctttggaggacaacagaaggaacttgaaaggtacaataaaaattta
gaagaagctaaaaatgttggcataaagaaagctatcacagccagcatttcgataggcatt
gcctacctgttggtctatgcatcatatgcactggcattctggtatgggacatccttggtc
ctctcaaatgaatattctattggagaagtgcttactgtcttcttctctattttgttgggg
acttttagtattggacacttggccccaaacatagaagcctttgcaaacgcacgaggggca
gcctttgaaatcttcaagataattgataacgagccaagcattgacagcttctcaacaaag
ggctacaaaccagacagtataatgggaaacttagagtttaaaaatgttcacttcaactac
ccatcgagaagcgaagttcagatcttgaagggcctcaatctgaaggtgaagagcggacag
acggtggccctggttggcaacagtggctgtggaaaaagcacaactgtccagctgatgcag
aggctctacgaccccctggagggcgtggtcagtatcgacggacaagacatcagaaccatc
aatgtgaggtatctgagggagatcattggtgtggtgagtcaggaacctgtgctgtttgcc
accacgatcgccgagaacattcgctatggccgagaagatgtcaccatggatgagattgag
aaagctgtcaaggaagccaatgcctatgacttcatcatgaaactgccccaccaatttgac
accctggttggtgagagaggggcgcagctgagtgggggacagaaacagagaatcgccatt
gcccgggccctggtccgcaatcccaagatccttttgttggacgaggccacctcagccctg
gatacagaaagtgaagctgtggtgcaggccgcactggataaggctagagaaggccggacc
accattgtgatagctcatcgcttgtctacagttcgtaatgctgacgtcattgctggtttt
gatggtggtgtcattgtggagcaaggaaatcatgatgagctcatgagagaaaagggcatt
tacttcaaacttgtcatgacacagactagaggaaatgaaattgaaccaggaaataatgct
tatggatcccagagtgacactgatgcttctgaactgacttcagaagaatccaaatcacct
ttaataaggagatcaatttacagaagtgtccacagaaagcaagaccaagagagaagactt
agtatgaaagaggctgtggatgaagatgtgcctctggtttccttttggcggatcctaaat
ctaaatctaagtgaatggccttatttacttgttggcgtactttgcgctgttataaatggg
tgcatacaaccagtgtttgccatagtattttcaaggattgtaggggttttttcaagagat
gatgaccatgaaactaaacgacagaattgtaatttgttttccctgttctttctggttatg
gggctgatttcttttgttacatatttctttcagggcttcacatttggcaaagccggagag
atcctcaccaagcgagtccgatacatggttttcaaatccatgctgagacaggatataagc
tggttcgatgaccataagaacagcactggctcactgaccaccaggctcgccagtgatgct
tctagtgttaaaggggcgatgggcgccaggcttgctgtagttacccagaatgtagcaaac
ctcgggacaggagtcatcctctccttagtctatggctggcagctgacacttctacttgta
gtaattataccgctcattgtattgggcggaattattgaaatgaagctgttgtctggccaa
gccttgaaggacaagaaacagcttgagatctctgggaagattgctacagaagcaattgaa
aacttccgcactattgtctctttgactcgggagcagaagtttgaaaccatgtatgcccag
agcttgcaggtaccatacagaaatgcgatgaagaaagcacacgtgtttgggatcacgttc
tccttcacccaggccatgatgtatttttcttatgctgcttgtttccggttcggtgcctac
ttggtggcacaacaactcatgacttttgaaaatgttatgttggtattttctgctgttgtc
tttggtgccatggcagctgggaatactagttcatttgctcctgactatgcgaaagccaaa
gtatcagcatctcatatcatcaggatcattgagaaaacccctgagattgacagctacagc
acagagggcttgaagcctactctgttagaaggaaatgtaaaatttaatggagtccagttt
aactatcccacccgacccaacatcccagtgcttcaggggctgagcctcgaggtgaagaag
ggccagacgttggccctggtgggcagcagtggctgtgggaagagcacagtggtccagctg
ctcgagcgcttctacgaccccatggctggatcagtgtttctagatggcaaagaaataaag
caactgaatgtccagtggctccgagctcaccttggcattgtgtcccaggagcccattctc
tttgactgcagcattgcagagaacatcgcctatggagacaacagccgggccgtgtctcat
gaggagattgtgagggcagccaaggaggccaacatccaccagttcatcgactcactgcct
gataaatacaacaccagagtaggagacaaaggcactcagctgtcgggtgggcagaagcag
cgcatcgccatcgcacgtgccctcgtcagacagcctcacattttacttctggacgaagca
acatcagctctggatacagaaagtgaaaaggttgtccaggaagcgctggacaaagccagg
gaaggccgcacctgcattgtgatcgctcaccgcctgtccaccatccagaacgcggacttg
atcgtggtgattgagaacggcaaagtcaaggagcacggcacccaccagcagctgctggcg
cagaagggcatctacttctcaatggtccaggctggagcaaagcgctcatga

KEGG   Mus musculus (mouse): 18671
Entry
18671             CDS       T01002                                 

Gene name
Abcb1a, Abcb4, Evi, Evi32, Mdr, Mdr1a, Mdr3, P, P-, P-gp, Pgp, Pgy, Pgy-, Pgy-3, Pgy3, mdr-, mdr-3
Definition
(RefSeq) ATP-binding cassette, sub-family B (MDR/TAP), member 1A
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu02010  ABC transporters
mmu04976  Bile secretion
mmu05206  MicroRNAs in cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    18671 (Abcb1a)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    18671 (Abcb1a)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    18671 (Abcb1a)
  09162 Cancer: specific types
   05226 Gastric cancer
    18671 (Abcb1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    18671 (Abcb1a)
   04147 Exosome [BR:mmu04147]
    18671 (Abcb1a)
   04090 CD molecules [BR:mmu04090]
    18671 (Abcb1a)
Enzymes [BR:mmu01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     18671 (Abcb1a)
Transporters [BR:mmu02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    18671 (Abcb1a)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   18671 (Abcb1a)
CD molecules [BR:mmu04090]
 Proteins
  18671 (Abcb1a)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_22 Rad17 Zeta_toxin RsgA_GTPase G-alpha AAA AAA_5 AAA_29 AAA_7 AAA_30 APS_kinase AAA_14 DUF815 PRK AAA_15 NTPase_1 DUF2057 DUF2207
Other DBs
NCBI-GeneID: 18671
NCBI-ProteinID: NP_035206
MGI: 97570
Ensembl: ENSMUSG00000040584
Vega: OTTMUSG00000029053
UniProt: P21447
LinkDB
Structure
PDB: 

Position
5 A1; 5 3.43 cM
AA seq 1276 aa
MELEEDLKGRADKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWLDRLYMLVGTLAAIIH
GVALPLMMLIFGDMTDSFASVGNVSKNSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAG
VLIVAYIQVSFWCLAAGRQIHKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINE
GIGDKIGMFFQAMATFFGGFIIGFTRGWKLTLVILAISPVLGLSAGIWAKILSSFTDKEL
HAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEAKRLGIKKAITANISMGAAFL
LIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEAFANARGAAYE
VFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVA
LVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTI
AENIRYGREDVTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARA
LVRNPKILLLDEATSALDTESEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGG
VIVEQGNHDELMREKGIYFKLVMTQTAGNEIELGNEACKSKDEIDNLDMSSKDSGSSLIR
RRSTRKSICGPHDQDRKLSTKEALDEDVPPASFWRILKLNSTEWPYFVVGIFCAIINGGL
QPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSLLFLILGIISFITFFLQGFTFGKAGEIL
TKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLG
TGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENF
RTVVSLTREQKFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLV
TQQLMTFENVLLVFSAIVFGAMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQ
GLKPNMLEGNVQFSGVVFNYPTRPSIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLE
RFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEE
IVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQPHILLLDEATS
ALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQK
GIYFSMVSVQAGAKRS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggaacttgaagaggaccttaagggaagagcagacaagaacttctcaaagatgggcaaa
aagagtaaaaaggagaagaaagaaaagaaaccagcagtcagtgtgcttacaatgtttcgt
tatgcaggttggctggacaggttgtacatgctggtgggaactctggctgctattatccat
ggagtggcgctcccacttatgatgctgatctttggtgacatgacagatagctttgcaagt
gtaggaaacgtctctaaaaacagtactaatatgagtgaggccgataaaagagccatgttt
gccaaactggaggaagaaatgaccacgtacgcctactattacaccgggattggtgctggt
gtgctcatagttgcctacatccaggtttcattttggtgcctggcagctggaagacagata
cacaagatcaggcagaagttttttcatgctataatgaatcaggagataggctggtttgat
gtgcatgacgttggggagctcaacacccggctcacagatgatgtttccaaaattaatgaa
ggaattggtgacaaaatcggaatgttcttccaggcaatggcaacattttttggtggtttt
ataataggatttacccgtggctggaagctaacccttgtgattttggccatcagccctgtt
cttggactgtcagctggtatttgggcaaagatattgtcttcatttactgataaggaactc
catgcttatgcaaaagctggagcagttgctgaagaagtcttagcagccatcagaactgtg
attgcgtttggaggacaaaagaaggaacttgaaaggtacaataacaacttggaagaagct
aaaaggctggggataaagaaagctatcacggccaacatctccatgggtgcagcttttctc
cttatctatgcatcatatgctctggcattctggtatgggacttccttggtcatctccaaa
gaatactctattggacaagtgctcactgtcttcttttccgtgttaattggagcattcagt
gttggacaggcatctccaaatattgaagccttcgccaatgcacgaggagcagcttatgaa
gtcttcaaaataattgataataagcccagtatagacagcttctcaaagagtgggcacaaa
ccagacaacatacaaggaaatctggaatttaagaatattcacttcagttacccatctcga
aaagaagttcagatcttgaagggcctcaatctgaaggtgaagagcggacagacggtggcc
ctggttggcaacagtggctgtggaaaaagcacaactgtccagctgatgcaaaggctctac
gaccccctagatggcatggtcagtatcgacggacaggacatcagaaccatcaatgtgagg
tatctgagggagatcattggtgtggtgagtcaggaacctgtgctgtttgccaccacgatc
gccgagaacattcgctatggccgagaagatgtcaccatggatgagattgagaaagctgtc
aaggaagccaatgcctatgacttcatcatgaaactgccccaccaatttgacaccctggtt
ggtgagagaggggcgcagctgagtgggggacagaaacagagaatcgccattgcccgggcc
ctggtccgcaatcccaagatccttttgttggacgaggccacctcagccctggatacagaa
agtgaagctgtggttcaggccgcactggataaggctagagaaggccggaccaccattgtg
atagctcatcgcttgtctaccgttcgtaatgctgacgtcattgctggttttgatggtggt
gtcattgtggagcaaggaaatcatgatgagctcatgagagaaaagggcatttacttcaaa
cttgtcatgacacagacagcaggaaatgaaattgaattaggaaatgaagcttgtaaatct
aaggatgaaattgataatttagacatgtcttcaaaagattcaggatccagtctaataaga
agaagatcaactcgcaaaagcatctgtggaccacatgaccaagacaggaagcttagtacc
aaagaggccctggatgaagatgtacctccagcttccttttggcggatcctgaagttgaat
tcaactgaatggccttattttgtggttggtatattctgtgccataataaatggaggctta
cagccagcattctccgtaatattttcaaaagttgtaggggtttttacaaatggtggcccc
cctgaaacccagcggcagaacagcaacttgttttccttgttgtttctgatccttgggatc
atttctttcattacattttttcttcagggcttcacatttggcaaagctggagagatcctc
accaagcgactccgatacatggttttcaaatccatgctgagacaggatgtgagctggttt
gatgaccctaaaaacaccaccggagcactgaccaccaggctcgccaacgatgctgctcaa
gtgaaaggggctacagggtctaggcttgctgtgattttccagaacatagcaaatcttggg
acaggaatcatcatatccctaatctatggctggcaactaacacttttactcttagcaatt
gtacccatcattgcgatagcaggagtggttgaaatgaaaatgttgtctggacaagcactg
aaagataagaaggaactagaaggttctggaaagattgctacggaagcaattgaaaacttc
cgcactgttgtctctttgactcgggagcagaagtttgaaaccatgtatgcccagagcttg
cagataccatacagaaatgcgatgaagaaagcacacgtgtttgggatcacgttctccttc
acccaggccatgatgtatttttcttatgctgcttgtttccggttcggtgcctacttggtg
acacaacaactcatgacttttgaaaatgttctgttagtattctcagctattgtctttggt
gccatggcagtggggcaggtcagttcattcgctcctgactatgcgaaagccacagtgtca
gcatcccacatcatcaggatcattgagaaaacccccgagattgacagctacagcacgcaa
ggcctaaagccgaatatgttggaaggaaatgtgcaatttagtggagtcgtgttcaactat
cccacccgacccagcatcccagtgcttcaggggctgagccttgaggtgaagaagggccag
acgctggccctggtgggcagcagtggctgcgggaagagcacagtggtccagctgctcgag
cgcttctacgaccccatggctggatcagtgtttctagatggcaaagaaataaagcaactg
aatgtccagtggctccgagcacagctgggcattgtgtcccaagagcccattctctttgac
tgcagcatcgcagagaacattgcctacggagacaacagccgggtcgtgtcttatgaggag
attgtgagggcagccaaggaggccaacatccaccagttcatcgactcgctacctgataaa
tacaacaccagagtaggagacaaaggcactcagctgtcgggtgggcagaagcagcgcatc
gccatcgcacgcgccctcgtcagacagcctcacattttacttctggacgaagcaacatca
gctctggatacagaaagtgaaaaggttgtccaggaagcgctggacaaagccagggaaggc
cgcacctgcattgtgatcgctcaccgcctgtccaccatccagaacgcggacttgatcgtg
gtgattcagaacggcaaggtcaaggagcacggcacccaccagcagctgctggcgcagaag
ggcatctacttctcaatggtcagtgtgcaggctggagcaaagcgctcatga

DBGET integrated database retrieval system