KEGG   Mus musculus (mouse): 18712Help
Entry
18712             CDS       T01002                                 

Gene name
Pim1, Pim-1
Definition
(RefSeq) proviral integration site 1
  KO
K04702  proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04630  Jak-STAT signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    18712 (Pim1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18712 (Pim1)
   05206 MicroRNAs in cancer
    18712 (Pim1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    18712 (Pim1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18712 (Pim1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18712 (Pim1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18712 (Pim1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   18712 (Pim1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Haspin_kinase APH Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 18712
NCBI-ProteinID: NP_032868
MGI: 97584
Ensembl: ENSMUSG00000024014
Vega: OTTMUSG00000046297
UniProt: P06803
LinkDB All DBs
Position
17 A3.3; 17 15.38 cM
AA seq 313 aa AA seqDB search
MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVAD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSDFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEDLARGFFWQVLEAVRHCHNCGVLHRDIKDENILIDLSRG
EIKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIKGQVFFRQTVSSECQHLIKWCLSLRPSDRPSFEEIRNHPWMQGDLLPQAAS
EIHLHSLSPGSSK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgtccaagatcaactccctggcccacctgcgcgccgcgccctgcaacgacctg
cacgccaccaagctggcgccgggcaaagagaaggagcccctggagtcgcagtaccaggtg
ggcccgctgttgggcagcggtggcttcggctcggtctactctggcatccgcgtcgccgac
aacttgccggtggccattaagcacgtggagaaggaccggatttccgattggggagaactg
cccaatggcacccgagtgcccatggaagtggtcctgttgaagaaggtgagctcggacttc
tcgggcgtcattagacttctggactggttcgagaggcccgatagtttcgtgctgatcctg
gagaggcccgaaccggtgcaagacctcttcgactttatcaccgaacgaggagccctacag
gaggacctggcccgaggattcttctggcaggtgctggaggccgtgcggcattgccacaac
tgcggggttctccaccgcgacatcaaggacgagaacatcttaatcgacctgagccgcggc
gaaatcaaactcatcgacttcgggtcgggggcgctgctcaaggacacagtctacacggac
tttgatgggacccgagtgtacagtcctccagagtggattcgctaccatcgctaccacggc
aggtcggcagctgtctggtcccttgggatcctgctctatgacatggtctgcggagatatt
ccgtttgagcacgatgaagagatcatcaagggccaagtgttcttcaggcaaactgtctct
tcagagtgtcagcaccttattaaatggtgcctgtccctgagaccatcagatcggccctcc
tttgaagaaatccggaaccatccatggatgcagggtgacctcctgccccaggcagcttct
gagatccatctgcacagtctgtcaccggggtccagcaagtag

KEGG   Mus musculus (mouse): 18715Help
Entry
18715             CDS       T01002                                 

Gene name
Pim2, DXCch3, Pim-2
Definition
(RefSeq) proviral integration site 2
  KO
K08806  proto-oncogene serine/threonine-protein kinase Pim-2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18715 (Pim2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    18715 (Pim2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18715 (Pim2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     18715 (Pim2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CAMK group
  PIM family [OT]
   18715 (Pim2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 18715
NCBI-ProteinID: NP_613072
MGI: 97587
Ensembl: ENSMUSG00000031155
Vega: OTTMUSG00000018000
UniProt: Q62070 Q8R1Z0
LinkDB All DBs
Position
X A1.1; X 3.55 cM
AA seq 370 aa AA seqDB search
MARATNLNAAPSAGASGPPDSLPSTLAPPSPGSPAALPRASTPCGLSGFSGLNIRSTSSM
LTKPLQGHPSPPVTPTQPPGGKDRAAFEAEYRLGPLLGKGGFGTVFAGHRVTDRRQVAIK
VISRNRVLGWSTVSDSVTCPLEVALLWKVGEGNGHPGVIRLLDWFETPEGFMLVLERPMP
AQDLFDYITEKGPLGESCSRSFFTQVVAAVQHCHARGVVHRDIKDENILIDLCRGSIKLI
DFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGVLLYDMVCGDIPFERD
QEILEAELHFPAHVSPDCCALIRRCLAPKPCSRPSLEEILLDPWMQSPAEEKPINSSKGS
PTPLPWSLLP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
ctggcgcgcgcgacgaatcttaacgctgcgccgtctgcaggcgcttccgggccgccagat
tccctgccttccaccctggcgccccccagccctggctctccggccgctctgccccgggca
tccacgccctgcgggctcagcggattcagcgggctcaatatacgcagcacctcctccatg
ttgaccaagcctctgcaggggcatccttcgccccctgtgacccccacgcagcctccagga
ggcaaggatcgggcagctttcgaggccgaataccgacttggccccctcctgggtaaggga
ggctttggcaccgtcttcgcgggacaccgcgtcacggatagacgtcaggtggccatcaaa
gtaatctcccggaaccgtgtgctaggctggtccaccgtgtcagactcagtcacctgccca
cttgaggttgcgctgctgtggaaggtgggtgaaggcaatggccatccgggtgtgatacgc
cttcttgactggttcgaaacacccgaaggcttcatgctggtccttgagcggcctatgcct
gctcaggatctcttcgactatatcacagagaaggggccgctgggtgaaagctgtagccgc
agcttctttacccaagtcgtggcagctgtccagcactgccacgcccgtggagttgtccat
cgggatatcaaggatgagaacatcctgatcgacctatgccggggttccattaaactcatt
gattttggttccggcgccctgcttcacgatgagccgtacactgactttgatgggacaaga
gtgtatagccctccagagtggatctcgcgacaccagtaccatgccctgccagcgaccgtc
tggtcactaggtgtcctactctatgacatggtctgtggggacattcccttcgagagagac
caggagattctggaggctgagctgcacttccctgctcatgtctccccagattgctgtgcc
ctaatccgccggtgcctggcccctaaaccctgctcccgaccctcactggaggagattctg
ctggacccctggatgcaatcaccagctgaagaaaagcccatcaactcctccaaaggaagc
cccacccccttgccctggtccctgcttccctag

DBGET integrated database retrieval system