KEGG   Mus musculus (mouse): 18751Help
Entry
18751             CDS       T01002                                 

Gene name
Prkcb, PKC-B, PKC-Beta, Pkcb, Prkcb1, Prkcb2
Definition
(RefSeq) protein kinase C, beta
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04150  mTOR signaling pathway
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04540  Gap junction
mmu04650  Natural killer cell mediated cytotoxicity
mmu04662  B cell receptor signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04925  Aldosterone synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04931  Insulin resistance
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04960  Aldosterone-regulated sodium reabsorption
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu05031  Amphetamine addiction
mmu05032  Morphine addiction
mmu05140  Leishmaniasis
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18751 (Prkcb)
   04015 Rap1 signaling pathway
    18751 (Prkcb)
   04010 MAPK signaling pathway
    18751 (Prkcb)
   04012 ErbB signaling pathway
    18751 (Prkcb)
   04310 Wnt signaling pathway
    18751 (Prkcb)
   04370 VEGF signaling pathway
    18751 (Prkcb)
   04064 NF-kappa B signaling pathway
    18751 (Prkcb)
   04066 HIF-1 signaling pathway
    18751 (Prkcb)
   04020 Calcium signaling pathway
    18751 (Prkcb)
   04070 Phosphatidylinositol signaling system
    18751 (Prkcb)
   04071 Sphingolipid signaling pathway
    18751 (Prkcb)
   04150 mTOR signaling pathway
    18751 (Prkcb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    18751 (Prkcb)
   04540 Gap junction
    18751 (Prkcb)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    18751 (Prkcb)
   04662 B cell receptor signaling pathway
    18751 (Prkcb)
   04666 Fc gamma R-mediated phagocytosis
    18751 (Prkcb)
   04670 Leukocyte transendothelial migration
    18751 (Prkcb)
   04062 Chemokine signaling pathway
    18751 (Prkcb)
  09152 Endocrine system
   04911 Insulin secretion
    18751 (Prkcb)
   04929 GnRH secretion
    18751 (Prkcb)
   04912 GnRH signaling pathway
    18751 (Prkcb)
   04921 Oxytocin signaling pathway
    18751 (Prkcb)
   04918 Thyroid hormone synthesis
    18751 (Prkcb)
   04919 Thyroid hormone signaling pathway
    18751 (Prkcb)
   04928 Parathyroid hormone synthesis, secretion and action
    18751 (Prkcb)
   04916 Melanogenesis
    18751 (Prkcb)
   04925 Aldosterone synthesis and secretion
    18751 (Prkcb)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18751 (Prkcb)
  09154 Digestive system
   04970 Salivary secretion
    18751 (Prkcb)
   04971 Gastric acid secretion
    18751 (Prkcb)
   04972 Pancreatic secretion
    18751 (Prkcb)
   04973 Carbohydrate digestion and absorption
    18751 (Prkcb)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    18751 (Prkcb)
   04961 Endocrine and other factor-regulated calcium reabsorption
    18751 (Prkcb)
  09156 Nervous system
   04724 Glutamatergic synapse
    18751 (Prkcb)
   04727 GABAergic synapse
    18751 (Prkcb)
   04725 Cholinergic synapse
    18751 (Prkcb)
   04728 Dopaminergic synapse
    18751 (Prkcb)
   04726 Serotonergic synapse
    18751 (Prkcb)
   04720 Long-term potentiation
    18751 (Prkcb)
   04730 Long-term depression
    18751 (Prkcb)
   04723 Retrograde endocannabinoid signaling
    18751 (Prkcb)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18751 (Prkcb)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18751 (Prkcb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18751 (Prkcb)
   05206 MicroRNAs in cancer
    18751 (Prkcb)
   05205 Proteoglycans in cancer
    18751 (Prkcb)
   05231 Choline metabolism in cancer
    18751 (Prkcb)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18751 (Prkcb)
   05214 Glioma
    18751 (Prkcb)
   05223 Non-small cell lung cancer
    18751 (Prkcb)
  09165 Substance dependence
   05031 Amphetamine addiction
    18751 (Prkcb)
   05032 Morphine addiction
    18751 (Prkcb)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    18751 (Prkcb)
   04933 AGE-RAGE signaling pathway in diabetic complications
    18751 (Prkcb)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18751 (Prkcb)
   05164 Influenza A
    18751 (Prkcb)
   05161 Hepatitis B
    18751 (Prkcb)
   05163 Human cytomegalovirus infection
    18751 (Prkcb)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18751 (Prkcb)
   05140 Leishmaniasis
    18751 (Prkcb)
   05143 African trypanosomiasis
    18751 (Prkcb)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18751 (Prkcb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18751 (Prkcb)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18751 (Prkcb)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18751 (Prkcb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 18751
NCBI-ProteinID: NP_001303601
MGI: 97596
Ensembl: ENSMUSG00000052889
Vega: OTTMUSG00000016521
UniProt: P68404
LinkDB All DBs
Position
7 F2; 7 65.75 cM
AA seq 671 aa AA seqDB search
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKIGQGTKAPEEKTANTISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcacagtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgtcaagtctgctgctttgttgtacacaagcgctgccatgag
ttcgtcacgttctcctgccccggtgcggacaagggcccggcctctgatgacccccggagc
aaacacaagtttaagatccacacgtactccagtcctaccttctgtgaccactgtggatcg
ctgctgtatggacttattcaccaggggatgaaatgcgacacctgtatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctctgcggcactgaccacacggaacgccgcggc
cgcatctatatccaggcccacatcgacagagaggttctcattgttgttgtaagagatgct
aaaaatctggtacctatggaccccaatggcttgtcagatccctacgttaaactgaaactg
atccctgatcccaaaagtgagagcaaacagaagaccaagaccatcaagtgttccctcaat
ccagagtggaatgaaaccttcagatttcagctgaaggaatcagacaaagacagaagactg
tctgtagagatctgggattgggacctgaccagcaggaatgacttcatgggatctctgtca
tttgggatttcagaactacagaaagccggtgtggatggctggttcaagttactaagccag
gaagagggtgaatacttcaatgtgcccgtgccgcccgaaggaagcgagggcaatgaagag
ctgcggcagaagtttgagagagccaagattggccaaggtaccaaggctccagaagaaaag
acagctaacactatctccaaatttgacaacaatggcaacagggaccggatgaaactgacc
gattttaacttcctgatggtgctggggaaaggcagctttggcaaggtcatgctctcagag
cggaagggtacagatgaactctatgccgtgaagatcctgaagaaggacgtggtgatccaa
gatgacgatgtggagtgcaccatggtggagaagcgggtgctggccctgcctgggaagccc
ccgttcctgactcagctccattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaacgggggtgacctcatgtaccacatccaacaagttggccgtttcaaggag
ccccatgctgtattttacgccgcagagattgccatcggtctgttcttcttgcagagcaag
ggcattatttaccgcgacctgaaacttgacaacgtgatgctggattctgaggggcacatc
aaaatcgctgactttggcatgtgtaaggagaacatctgggatggggtgacaaccaagaca
ttctgtggcactccggactacattgctccagagatcattgcttatcagccctacgggaag
tctgtggactggtgggcatttggagtcctgctgtatgaaatgttggctggccaggcaccg
tttgaaggggaggatgaggatgaactcttccagtcaatcatggaacacaatgtggcgtat
cccaagtccatgtccaaggaagccgtggcaatctgcaaagggctaatgaccaaacaccca
ggcaagcgcctgggttgtgggcctgaaggggaacgagacattaaggagcatgcgtttttc
cggtatattgactgggagaaactcgaacgcaaggagattcagccaccttataaaccaaaa
gctagagacaagcgagacacctccaacttcgacaaagagttcaccaggcagcctgtggaa
ctgactcccactgacaaactcttcatcatgaacttggaccaaaatgagtttgctggcttc
tcgtatactaacccagagtttgtcattaatgtgtag

DBGET integrated database retrieval system