KEGG   Mus musculus (mouse): 18761Help
Entry
18761             CDS       T01002                                 

Gene name
Prkcq, A130035A12Rik, AW494342, PKC-0, PKC-theta, PKCtheta, Pkcq
Definition
(RefSeq) protein kinase C, theta
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04140  Autophagy - animal
mmu04270  Vascular smooth muscle contraction
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04920  Adipocytokine signaling pathway
mmu04931  Insulin resistance
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    18761 (Prkcq)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    18761 (Prkcq)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    18761 (Prkcq)
   04658 Th1 and Th2 cell differentiation
    18761 (Prkcq)
   04659 Th17 cell differentiation
    18761 (Prkcq)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    18761 (Prkcq)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    18761 (Prkcq)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18761 (Prkcq)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18761 (Prkcq)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    18761 (Prkcq)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    18761 (Prkcq)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     18761 (Prkcq)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   18761 (Prkcq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like zf-RING_9 Haspin_kinase C1_2 Zf_RING APH
Motif
Other DBs
NCBI-GeneID: 18761
NCBI-ProteinID: NP_032885
MGI: 97601
Ensembl: ENSMUSG00000026778
Vega: OTTMUSG00000011317
UniProt: Q02111 A6H667
LinkDB All DBs
Structure
PDB: 

Position
2 A1; 2 8.42 cM
AA seq 707 aa AA seqDB search
MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISWDSPLDGSNKSAGPP
EPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD
CSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgtttcttcgaatcggtttatccaactttgactgtgggacctgccaagcttgt
cagggagaggcagtgaacccctactgcgctgtgcttgtcaaagagtatgtggaatcagaa
aatgggcagatgtacatccagaaaaagccaaccatgtacccaccttgggacagcaccttt
gacgcccacattaacaagggaagggtgatgcagatcatcgtgaagggcaagaatgtagac
ctcatctcagaaacaaccgtggaactctactccctggcggagagatgccgcaagaacaat
gggcggacagaaatatggttagagctgaaacctcaaggccgaatgctaatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgagtgagtttgagaatgaaggattcttt
gcactgcatcagcgccgaggagccatcaaacaggccaaagtccaccatgtcaagtgtcac
gagttcacggccacctttttccctcaacccacattttgctctgtctgccatgaatttgtc
tggggcctgaacaagcagggttaccagtgccgacagtgtaatgcagcgattcacaagaag
tgcattgataaagtgatagccaagtgcacaggatccgcaatcaatagccgagaaaccatg
ttccataaggagagattcaagatcgacatgccacacagattcaaagtctacaactacaag
agtccaaccttctgtgagcactgtggtaccctgctctgggggctggcgaggcaaggactc
aaatgtgatgcatgtggcatgaacgtccaccaccgatgccagacaaaggttgccaatctt
tgtggtataaaccagaagctaatggctgaagcactagcgatgattgaaagcacccaacag
gctcgctccttacgagattcagaacacatcttccgagaaggcccagttgaaattggtctc
ccatgctccaccaaaaacgaaaccaggccaccatgcgtaccaacacctgggaaaagagaa
ccccagggcatttcctgggattcccctttggatgggtcaaataaatcggccggtcctcct
gaacccgaagtgagcatgcgcaggacttcactgcagctgaaactgaagatcgatgacttc
atcctgcacaagatgttgggaaaaggaagttttggcaaggtcttcctggcagagttcaag
agaaccaatcagtttttcgcaataaaagccttaaagaaagatgtggtgttgatggatgat
gacgtcgagtgtacaatggtggaaaagagggttctgtccttggcatgggagcatccattt
ctaacacacatgttctgcacattccagaccaaggaaaatctctttttcgtgatggagtat
ctcaatggaggcgacttaatgtaccacatccaaagttgccacaaatttgatctttccaga
gccacgttttatgctgctgaggtcatccttggtctgcagttccttcattccaaaggaatt
gtctacagggacctgaagcttgataatatcctgttagacagagatggacatatcaaaata
gcagactttgggatgtgcaaagagaacatgctaggagatgcgaagacaaatactttctgt
ggaactcctgactacattgctccggagatcttgctgggtcagaagtacaaccattccgtc
gactggtggtccttcggggtgctcgtttatgagatgctgattggccagtcccccttccac
gggcaggacgaggaggagctgttccactccatccgcatggacaaccccttctacccgagg
tggctcgaaagggaggccaaggaccttctagtgaagctttttgtgagagaacctgagaag
aggctgggagtgagaggagacatccgccagcatcctttgtttcgagagatcaactgggaa
gagcttgaaaggaaagagattgacccacccttcagaccaaaagtgaaatcaccatatgac
tgtagcaatttcgacaaggaattcctaagtgagaaaccccggctatcattcgccgacaga
gcactcatcaacagcatggaccagaacatgttcagcaacttttccttcattaacccaggg
atggagactctcatttgctcctga

DBGET integrated database retrieval system