KEGG   Mus musculus (mouse): 18792Help
Entry
18792             CDS       T01002                                 

Gene name
Plau, u-PA, uPA
Definition
(RefSeq) plasminogen activator, urokinase
  KO
K01348  urokinase plasminogen activator [EC:3.4.21.73]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04610  Complement and coagulation cascades
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    18792 (Plau)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    18792 (Plau)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    18792 (Plau)
   05206 MicroRNAs in cancer
    18792 (Plau)
   05205 Proteoglycans in cancer
    18792 (Plau)
  09162 Cancer: specific types
   05215 Prostate cancer
    18792 (Plau)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    18792 (Plau)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    18792 (Plau)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     18792 (Plau)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   18792 (Plau)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Haparin
  Coagulation and fibrinolysis
   18792 (Plau)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Kringle DUF316 Prokineticin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 18792
NCBI-ProteinID: NP_032899
MGI: 97611
Ensembl: ENSMUSG00000021822
UniProt: P06869 Q0VBA8
LinkDB All DBs
Structure
PDB: 

Position
14 A3; 14 11.53 cM
AA seq 433 aa AA seqDB search
MKVWLASLFLCALVVKNSEGGSVLGAPDESNCGCQNGGVCVSYKYFSRIRRCSCPRKFQG
EHCEIDASKTCYHGNGDSYRGKANTDTKGRPCLAWNAPAVLQKPYNAHRPDAISLGLGKH
NYCRNPDNQKRPWCYVQIGLRQFVQECMVHDCSLSKKPSSSVDQQGFQCGQKALRPRFKI
VGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVASAAHCFIQLPKKENYVVY
LGQSKESSYNPGEMKFEVEQLILHEYYREDSLAYHNDIALLKIRTSTGQCAQPSRSIQTI
CLPPRFTDAPFGSDCEITGFGKESESDYLYPKNLKMSVVKLVSHEQCMQPHYYGSEINYK
MLCAADPEWKTDSCKGDSGGPLICNIEGRPTLSGIVSWGRGCAEKNKPGVYTRVSHFLDW
IQSHIGEEKGLAF
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctggctggcgagcctgttcctctgcgccttggtggtgaaaaactctgaaggt
ggcagtgtacttggagctcctgatgaatcaaactgtggctgtcagaacggaggtgtatgc
gtgtcctacaagtacttctccagaattcgccgatgcagctgcccaaggaaattccagggg
gagcactgtgagatagatgcatcaaaaacctgctatcatggaaatggtgactcttaccga
ggaaaggccaacactgataccaaaggtcggccctgcctggcctggaatgcgcctgctgtc
cttcagaaaccctacaatgcccacagacctgatgctattagcctaggcctggggaaacac
aattactgcaggaaccctgacaaccagaagcgaccctggtgctatgtgcagattggccta
aggcagtttgtccaagaatgcatggtgcatgactgctctcttagcaaaaagccttcttcg
tctgtagaccaacaaggcttccagtgtggccagaaggctctaaggccccgctttaagatt
gttgggggagaattcactgaggtggagaaccagccctggttcgcagccatctaccagaag
aacaagggaggaagtcctccctcctttaaatgtggtgggagtctcatcagtccttgctgg
gtggccagtgccgcacactgcttcattcaactcccaaagaaggaaaactacgttgtctac
ctgggtcagtcgaaggagagctcctataatcctggagagatgaagtttgaggtggagcag
ctcatcttgcacgaatactacagggaagacagcctggcctaccataatgatattgccttg
ctgaagatacgtaccagcacgggccaatgtgcacagccatccaggtccatacagaccatc
tgcctgcccccaaggtttactgatgctccgtttggttcagactgtgagatcactggcttt
ggaaaagagtctgaaagtgactatctctatccaaagaacctgaaaatgtccgtcgtaaag
cttgtttctcatgaacagtgtatgcagccccactactatggctctgaaattaattataaa
atgctgtgtgctgcggacccagagtggaaaacagattcctgcaagggcgattctggagga
ccgcttatctgtaacatcgaaggccgcccaactctgagtgggattgtgagctggggccga
ggatgtgcagagaaaaacaagcccggtgtctacacgagggtctcacacttcctggactgg
attcaatcccacattggagaagagaaaggtctggccttctga

DBGET integrated database retrieval system