KEGG   Mus musculus (mouse): 18795Help
Entry
18795             CDS       T01002                                 

Gene name
Plcb1, 3110043I21Rik, AI132408, Plcb, mKIAA0581
Definition
(RefSeq) phospholipase C, beta 1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18795 (Plcb1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18795 (Plcb1)
   04310 Wnt signaling pathway
    18795 (Plcb1)
   04371 Apelin signaling pathway
    18795 (Plcb1)
   04020 Calcium signaling pathway
    18795 (Plcb1)
   04070 Phosphatidylinositol signaling system
    18795 (Plcb1)
   04072 Phospholipase D signaling pathway
    18795 (Plcb1)
   04071 Sphingolipid signaling pathway
    18795 (Plcb1)
   04022 cGMP-PKG signaling pathway
    18795 (Plcb1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    18795 (Plcb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18795 (Plcb1)
   04621 NOD-like receptor signaling pathway
    18795 (Plcb1)
   04062 Chemokine signaling pathway
    18795 (Plcb1)
  09152 Endocrine system
   04911 Insulin secretion
    18795 (Plcb1)
   04922 Glucagon signaling pathway
    18795 (Plcb1)
   04929 GnRH secretion
    18795 (Plcb1)
   04912 GnRH signaling pathway
    18795 (Plcb1)
   04915 Estrogen signaling pathway
    18795 (Plcb1)
   04921 Oxytocin signaling pathway
    18795 (Plcb1)
   04926 Relaxin signaling pathway
    18795 (Plcb1)
   04918 Thyroid hormone synthesis
    18795 (Plcb1)
   04919 Thyroid hormone signaling pathway
    18795 (Plcb1)
   04928 Parathyroid hormone synthesis, secretion and action
    18795 (Plcb1)
   04916 Melanogenesis
    18795 (Plcb1)
   04924 Renin secretion
    18795 (Plcb1)
   04925 Aldosterone synthesis and secretion
    18795 (Plcb1)
   04927 Cortisol synthesis and secretion
    18795 (Plcb1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18795 (Plcb1)
   04270 Vascular smooth muscle contraction
    18795 (Plcb1)
  09154 Digestive system
   04970 Salivary secretion
    18795 (Plcb1)
   04971 Gastric acid secretion
    18795 (Plcb1)
   04972 Pancreatic secretion
    18795 (Plcb1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18795 (Plcb1)
  09156 Nervous system
   04724 Glutamatergic synapse
    18795 (Plcb1)
   04725 Cholinergic synapse
    18795 (Plcb1)
   04728 Dopaminergic synapse
    18795 (Plcb1)
   04726 Serotonergic synapse
    18795 (Plcb1)
   04720 Long-term potentiation
    18795 (Plcb1)
   04730 Long-term depression
    18795 (Plcb1)
   04723 Retrograde endocannabinoid signaling
    18795 (Plcb1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18795 (Plcb1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18795 (Plcb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18795 (Plcb1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18795 (Plcb1)
   05016 Huntington disease
    18795 (Plcb1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18795 (Plcb1)
   04934 Cushing syndrome
    18795 (Plcb1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18795 (Plcb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18795 (Plcb1)
   05142 Chagas disease (American trypanosomiasis)
    18795 (Plcb1)
   05143 African trypanosomiasis
    18795 (Plcb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18795 (Plcb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18795 (Plcb1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18795 (Plcb1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18795 (Plcb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Motif
Other DBs
NCBI-GeneID: 18795
NCBI-ProteinID: NP_001139302
MGI: 97613
Ensembl: ENSMUSG00000051177
Vega: OTTMUSG00000015592
UniProt: Q9Z1B3 Q3UPW0
LinkDB All DBs
Position
2 F3; 2 65.66 cM
AA seq 1216 aa AA seqDB search
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGKHAKAPKDPKLRELLDVGNIGHLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPDVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNSSLAKKGQMSVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSVFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPSLACLRIAAYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETSSEAPSETRTTPAENGVNHTASLAPKPPSQAPHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTELIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSAIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHNEIRQQILDEKP
KLQTELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPPSLASDAAKVNLKSPSS
EEIERENPGREFDTPL
NT seq 3651 nt NT seq  +upstreamnt  +downstreamnt
atggctggggctcagcccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactccactattgttactcca
attattttgaggactgatcctcagggatttttcttttactggacagaccagaataaggag
acggagctgttagatctcagccttgtcaaggatgccaggtgtgggaagcacgccaaagct
cccaaggaccccaagttgcgtgaacttctggatgttgggaacatcggacacttggaacag
cgcatgataactgtggtgtatggaccagacctggtgaacatttcccacttgaatcttgtg
gcttttcaagaggaagtagccaaggaatggacaaatgaggttttcagcttggcaacaaac
ctgctggctcagaacatgtccagggacgcatttctggagaaagcatatactaagctcaag
ctccaggtcaccccagaaggccgcattcctcttaaaaacatctatcgattgttctcagca
gaccggaagcgcgttgaaactgcactagaggcttgtagtcttccatcttcgaggaatgac
tccattccccaagaggacttcactccagatgtatacagagttttcctgaacaatctctgt
ccccgacctgaaattgataacatcttttctgaatttggtgccaaaagcaaaccgtacctg
acggttgatcagatgatggattttatcaaccttaagcagagagatccccggctcaatgaa
atcctttacccacctctgaagcaggagcaggtccaagtgttgattgagaaatatgagccc
aacagcagcctcgccaagaaagggcagatgtcagtggatggattcatgcgctacctgagc
ggagaagaaaatggagtcgtttcacctgagaaactggatttgaacgaagacatgtctcag
cccctgtctcactatttcatcaattcctcgcacaacacctacctcacagctggccagttg
gctgggaactcgtctgtagagatgtatcgccaggtgcttctgtctggatgtcgctgtgtg
gagctggactgctggaagggaaggaccgctgaggaagagcctgtcattacccatggattc
accatgacaacagaaatatccttcaaggaagtcatagaagccatcgcagagtgtgcgttc
aagacgtctcctttccccatcctcctttcctttgagaaccacgtggattccccgaagcaa
caagccaagatggccgagtattgccgattaatctttggtgatgccctcctgatggaacca
ctggaaaaatacccactggaatctggggtacctcttccaagccctatggatttaatgtat
aaaatcttggtgaaaaacaagaagaagtcgcacaagtcgtcagagggaagtggtaagaag
aagctttcagagcaagcttccaacacctacagcgactcctccagtgtgttcgagccttcg
tctccaggagctggggaagcagatacggagagtgatgacgatgacgacgacgatgactgt
aaaaagtcttccatggatgaggggacagctggcagcgaagccatggccacagaagagatg
tctaacctggtgaactatattcagcctgtcaagtttgagtcctttgaaatttcaaaaaaa
agaaataaaagctttgaaatgtcttccttcgtggaaaccaaaggacttgaacaacttaca
aagtctccggtggaatttgtagaatacaacaagatgcaacttagcaggatatatcccaag
ggaacacgtgtggattcatccaactacatgcctcaactcttctggaatgctggctgtcag
atggtggcgctcaacttccagacagtggatctagctatgcagataaacatgggcatgtat
gagtacaatgggaagagcggctataggctgaagccagagttcatgaggaggccggacaag
cattttgatccatttactgaaggaatcgtagatgggatagtggccaacactctatctgtt
aagattatttcaggtcagttcctctctgataagaaagttgggacttatgtggaagtggat
atgtttggcttgcctgtggacacaaggaggaaggcatttaaaaccaagacatcccaagga
aatgctgtaaaccctgtctgggaagaagaacctattgtattcaaaaaggtagttctacct
tctctggcctgtttgaggatagcagcatatgaagagggaggcaaatttattggccaccgg
atattgcctgtgcaggctattcggccaggctatcactacatctgcctgcggaatgagagg
aaccagcccctgacgctgccagctgtctttgtctacatagaagtcaaagattatgtgcca
gacacgtatgcagatgtaatcgaagctctatcaaacccaatccgatatgtcaatctgatg
gaacagagagctaagcagctggctgcgttgaccctggaggatgaagaggaagtaaagaag
gaggctgaccctggagaaacatcttccgaggctccaagcgaaaccaggacaacgccagca
gagaatggggtgaatcacaccgcatcccttgcacccaagccgccttcccaggctccacac
agccagcctgctccagggtctgtgaaggcacctgccaaaacagaagatctgatccagagc
gtgttaacagaagtagaggcgcaaaccatcgaagagctcaagcaacagaaatcgttcgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggtgaagagacaccacaagaaa
accacggagctcattaaggagcacacgaccaagtacaacgagattcagaatgactacctg
agaaggagggcagccttggagaagtccgccaaaaaggacagcaagaagaaatctgaaccc
agcagccctgaccacggctcatcagccattgagcaagacctcgctgccctggatgcagaa
atgactcagaagttgatagacttgaaagacaagcaacaacagcagctgcttaatcttcgg
caagagcagtattacagcgagaagtaccaaaagcgagaacacattaaactgcttattcag
aagttgacagatgttgcagaagagtgtcagaacaatcagttaaagaagctgaaggaaatc
tgcgagaaagagaagaaggaattaaagaagaaaatggataagaagaggcaagagaagata
acagaagccaagtccaaagacaaaagccagatggaagaggagaagacagagatgatccga
tcgtacatccaggaggtggttcagtacatcaagaggttagaggaagcacaaagtaaaaga
caagaaaaactcgtggagaaacacaatgagatccgccagcagatcctcgatgagaagccc
aagctgcagacggagctggagcaagaataccaagacaagttcaaaaggctgcccctggag
attctggagtttgtacaggaagccatgaaagggaagatcagcgaggacagcaatcacggc
tctgcccctccctctctggcctcagatgctgcaaaggtgaacctcaagtctccctccagt
gaggagatagaaagagagaacccaggaagagagtttgatactcctctgtga

KEGG   Mus musculus (mouse): 18796Help
Entry
18796             CDS       T01002                                 

Gene name
Plcb2, AI550384, B230205M18Rik, B230399N12
Definition
(RefSeq) phospholipase C, beta 2
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18796 (Plcb2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18796 (Plcb2)
   04310 Wnt signaling pathway
    18796 (Plcb2)
   04371 Apelin signaling pathway
    18796 (Plcb2)
   04020 Calcium signaling pathway
    18796 (Plcb2)
   04070 Phosphatidylinositol signaling system
    18796 (Plcb2)
   04072 Phospholipase D signaling pathway
    18796 (Plcb2)
   04071 Sphingolipid signaling pathway
    18796 (Plcb2)
   04022 cGMP-PKG signaling pathway
    18796 (Plcb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    18796 (Plcb2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18796 (Plcb2)
   04621 NOD-like receptor signaling pathway
    18796 (Plcb2)
   04062 Chemokine signaling pathway
    18796 (Plcb2)
  09152 Endocrine system
   04911 Insulin secretion
    18796 (Plcb2)
   04922 Glucagon signaling pathway
    18796 (Plcb2)
   04929 GnRH secretion
    18796 (Plcb2)
   04912 GnRH signaling pathway
    18796 (Plcb2)
   04915 Estrogen signaling pathway
    18796 (Plcb2)
   04921 Oxytocin signaling pathway
    18796 (Plcb2)
   04926 Relaxin signaling pathway
    18796 (Plcb2)
   04918 Thyroid hormone synthesis
    18796 (Plcb2)
   04919 Thyroid hormone signaling pathway
    18796 (Plcb2)
   04928 Parathyroid hormone synthesis, secretion and action
    18796 (Plcb2)
   04916 Melanogenesis
    18796 (Plcb2)
   04924 Renin secretion
    18796 (Plcb2)
   04925 Aldosterone synthesis and secretion
    18796 (Plcb2)
   04927 Cortisol synthesis and secretion
    18796 (Plcb2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18796 (Plcb2)
   04270 Vascular smooth muscle contraction
    18796 (Plcb2)
  09154 Digestive system
   04970 Salivary secretion
    18796 (Plcb2)
   04971 Gastric acid secretion
    18796 (Plcb2)
   04972 Pancreatic secretion
    18796 (Plcb2)
   04973 Carbohydrate digestion and absorption
    18796 (Plcb2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18796 (Plcb2)
  09156 Nervous system
   04724 Glutamatergic synapse
    18796 (Plcb2)
   04725 Cholinergic synapse
    18796 (Plcb2)
   04728 Dopaminergic synapse
    18796 (Plcb2)
   04726 Serotonergic synapse
    18796 (Plcb2)
   04720 Long-term potentiation
    18796 (Plcb2)
   04730 Long-term depression
    18796 (Plcb2)
   04723 Retrograde endocannabinoid signaling
    18796 (Plcb2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18796 (Plcb2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18796 (Plcb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18796 (Plcb2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18796 (Plcb2)
   05016 Huntington disease
    18796 (Plcb2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18796 (Plcb2)
   04934 Cushing syndrome
    18796 (Plcb2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18796 (Plcb2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18796 (Plcb2)
   05142 Chagas disease (American trypanosomiasis)
    18796 (Plcb2)
   05143 African trypanosomiasis
    18796 (Plcb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18796 (Plcb2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18796 (Plcb2)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18796 (Plcb2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18796 (Plcb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2
Motif
Other DBs
NCBI-GeneID: 18796
NCBI-ProteinID: NP_808236
MGI: 107465
Ensembl: ENSMUSG00000040061
Vega: OTTMUSG00000015372
UniProt: A3KGF7
LinkDB All DBs
Position
2 E5; 2 59.43 cM
AA seq 1181 aa AA seqDB search
MSLLNPVLLPPNVKAYLSQGERFIKWDDETSIASPVILRVDPKGYYLYWTYQNQEMEFLD
VTSIRDTRFGKFAKIPKSQKLREVFNMDFPDNHFLLKTLTVVSGPDMVDLTFYNFVSYKE
NVGKDWAEDVLALAKHPMTVNAPRSTFLDKILVKLKMQLNPEGKIPVKNFFQMFPADRKR
VEAALGACHLAKGKNDAINPEDFPESVYKSFLMSLCPRPEIDEIFTSYHSKAKPYMTKEH
LTKFINQKQRDPRLNSLLFPPARPEQVQVLIDKYEPSGINVQRGQLSPEGMVWFLCGPEN
SVLAHDTLLIHQDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDILFKEAIEAIAESAFKTSPYPVILSFENHVDSPRQQAKM
AEYCRSMFGETLLTDPLENFPLKPGIPLPSPEDLRGKILIKNKKNQFSGPASPSKKPGGV
AEGSLPSSVPVEEDTGWTAEDRTEVEEEEVVEEEEEEESGNLDEEEIKKMQSDEGTAGLE
VTAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVVSSFTELKAYELLSKASMQFVDYNKRQ
MSRVYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMALFEFNGQSGYLLKHE
FMRRLDKQFNPFSVDRIDVVVATTLSITIISGQFLSERSVRTYVEVELFGLPGDPKRRYR
TKLSPTANSINPVWKEEPFIFEKILMPELASLRIAVMEEGSKFLGHRIIPINALHSGYHH
LCLRSESNMALTMPALFVFLEMKDYIPDTWADLTVALANPIKYFNAQDKKSVKLKGVTGS
LPEKLFSGTPVASQSNGAPVSAGNGSTAPGTKATGEEATKEVTEPQTASLEELRELKGVV
KLQRRHEKELRELERRGARRWEELLQRGAAQLAELQTQAAGCKLRPGKGSRKKRTLPCEE
TVVAPSEPHDRADPRVQELKDRLEQELQQQGEEQYRSVLKRKEQHVTEQIAKMMELAREK
QAAELKTFKETSETDTKEMKKKLEAKRLERIQAMTKVTTDKVAQERLKREINNSHIQEVV
QAVKQMTETLERHQEKLEERQTACLEQIQAMEKQFQEKALAEYEAKMKGLEAEVKESVRA
YFKDCFPTEAEDKPERSCEASEESCPQEPLVSKADTQESRL
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgctcaaccctgttctattgccccctaacgtgaaggcatatctgagccaaggg
gagcgcttcatcaagtgggacgatgaaacttcaatagcctctcctgttatcctccgtgtg
gatcccaagggctattacttatactggacatatcaaaatcaggagatggagttcctggat
gtcacgagtatccgagatactcgctttgggaagtttgcaaagatacccaagagccagaaa
ctccgggaggtcttcaacatggactttccagacaaccacttcctgctgaaaacactcaca
gtggtgtccggccctgacatggtggacctcaccttctacaactttgtctcttacaaggag
aacgtaggcaaggactgggctgaggacgtgctagctctcgccaaacacccgatgacagtc
aatgctcctcgaagcacattcctggacaagatcctggtgaagcttaagatgcagctcaac
cctgaagggaagattcccgtgaagaattttttccagatgtttcctgctgatcgaaaacgg
gtggaagctgccctcggtgcttgtcaccttgcaaaaggcaaaaatgatgctatcaaccca
gaggacttcccagaatccgtgtacaagagcttcctcatgagcctctgtcctcggccagaa
atcgacgagatcttcacttcctaccactctaaagctaagccctacatgaccaaggaacac
ctgaccaaattcatcaatcagaagcagcgagaccctcgactcaactccttgctgttccca
ccagcccggcctgagcaagttcaagtgctcattgacaagtacgaacccagcggcatcaat
gtgcagaggggccagctgtcaccagaggggatggtctggtttctctgtggaccagagaac
agtgtgctggcccacgatacactgctgatccaccaagacatgacacaaccactgaatcac
tatttcatcaactcctcacacaacacctacctgacagccggccagttctcaggcctttcc
tcggctgagatgtaccgccaggtgctgctgtctggctgccggtgtgtagagttagactgt
tggaagggcaagccccctgacgaagagcccattatcacccacggcttcaccatgaccaca
gatatcttgttcaaggaagcaattgaagccattgcagaaagtgcctttaagacctccccg
tatcctgtcatcctatcatttgaaaaccatgtagactcaccccggcaacaggctaagatg
gctgagtactgcaggagcatgtttggagagaccttgctcacagatcccctggaaaatttc
cctctgaaacctggcatccctctgcccagccccgaggacctccggggcaagatcctcatt
aagaataagaagaaccagttttctgggccagcatcccccagcaagaagcctggtggggtg
gctgagggcagcctcccgtctagtgtccctgtagaagaggacacggggtggactgctgag
gaccggactgaggtggaggaggaggaggtggtggaagaggaggaagaggaggagtcagga
aacctggatgaagaagaaattaagaagatgcagtcggatgagggcacagcaggcctggag
gtgacagcttatgaggaaatgtccagccttgtcaattatatccagcccaccaagtttatc
tccttcgagttctctgcacagaagaacagaagttacgttgtctcttccttcacggagctc
aaggcctacgagctgctctccaaggcctccatgcagtttgtggactataataaacgccag
atgagccgtgtgtaccccaagggcacacgcatggactcttccaactacatgccccagatg
ttctggaatgctggatgtcagatggttgccctcaatttccagacaatggacctgcccatg
cagcagaacatggcactgtttgagttcaacgggcagagtggctacctcctaaagcacgag
ttcatgcgcagactggacaagcagttcaaccccttctcagtggaccgcattgatgtggtg
gtagccaccaccctttccattacgatcatctctgggcagttcctgtcagagcgcagtgta
cgcacctatgtggaagtggaactgtttggcctcccaggggaccccaagaggcggtatcga
accaagctgtcacctactgctaactccatcaatcctgtctggaaagaggaaccctttatc
tttgagaagatcttgatgcctgagctggcctccctcaggatagctgtgatggaagaaggc
agcaaatttcttggacaccgcatcatccccatcaatgccttacattctggataccaccat
ctgtgcctgcgcagtgagagcaacatggcccttaccatgccagctctctttgtcttcctg
gagatgaaggactacatacctgacacctgggcagatcttacagtagcccttgccaacccc
atcaagtacttcaatgcccaggataagaagtccgtgaagctcaaaggagtgacaggaagt
ctgcccgagaaactcttctctgggacacctgttgccagtcagtccaatggggcgccagtc
tcggcaggcaatgggtcaacagcgcctgggaccaaggccacgggggaagaagctacgaaa
gaagtgacagagccacagaccgccagcttggaagagttgcgggaactgaagggcgtggtg
aaactgcagcgaagacatgagaaggagcttcgagagttggagcgccgtggagcccggcgc
tgggaggaactgctgcagcgtggcgccgcacagctggcggagctccagacccaggcagca
ggctgcaagctccgcccaggcaagggctcccgcaagaagaggaccctgccctgtgaggag
accgtcgtggcgcctagcgagccccacgaccgggcggacccgcgcgtgcaggagctgaag
gacaggctggagcaggagctgcagcagcaaggcgaggagcagtaccgctccgtcctcaag
cgcaaggagcagcacgtgaccgagcaaatcgccaagatgatggagctggccagagagaaa
caggctgctgaactcaagaccttcaaggagacctcagaaactgacaccaaagaaatgaag
aaaaaactggaggccaagaggctggaacggatccaagccatgaccaaggtcaccacagac
aaggtggcccaggagaggctcaagagagaaattaacaactcccacatccaggaagtggtc
caggctgtcaagcagatgacagagaccctggagcgtcaccaggagaagctggaagagagg
cagacagcctgcctggagcagatccaggcaatggaaaagcagttccaggagaaggcgctg
gcagagtatgaggccaagatgaagggcctggaggctgaagtaaaggagtcggtgcgggcc
tacttcaaggactgcttccccaccgaagcagaagacaagcctgagaggtcctgtgaggcc
tctgaggagtcgtgtccacaggaaccacttgtgagcaaggcagacactcaggagagccgc
ctctga

KEGG   Mus musculus (mouse): 18797Help
Entry
18797             CDS       T01002                                 

Gene name
Plcb3, mKIAA4098
Definition
(RefSeq) phospholipase C, beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18797 (Plcb3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18797 (Plcb3)
   04310 Wnt signaling pathway
    18797 (Plcb3)
   04371 Apelin signaling pathway
    18797 (Plcb3)
   04020 Calcium signaling pathway
    18797 (Plcb3)
   04070 Phosphatidylinositol signaling system
    18797 (Plcb3)
   04072 Phospholipase D signaling pathway
    18797 (Plcb3)
   04071 Sphingolipid signaling pathway
    18797 (Plcb3)
   04022 cGMP-PKG signaling pathway
    18797 (Plcb3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    18797 (Plcb3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18797 (Plcb3)
   04621 NOD-like receptor signaling pathway
    18797 (Plcb3)
   04062 Chemokine signaling pathway
    18797 (Plcb3)
  09152 Endocrine system
   04911 Insulin secretion
    18797 (Plcb3)
   04922 Glucagon signaling pathway
    18797 (Plcb3)
   04929 GnRH secretion
    18797 (Plcb3)
   04912 GnRH signaling pathway
    18797 (Plcb3)
   04915 Estrogen signaling pathway
    18797 (Plcb3)
   04921 Oxytocin signaling pathway
    18797 (Plcb3)
   04926 Relaxin signaling pathway
    18797 (Plcb3)
   04918 Thyroid hormone synthesis
    18797 (Plcb3)
   04919 Thyroid hormone signaling pathway
    18797 (Plcb3)
   04928 Parathyroid hormone synthesis, secretion and action
    18797 (Plcb3)
   04916 Melanogenesis
    18797 (Plcb3)
   04924 Renin secretion
    18797 (Plcb3)
   04925 Aldosterone synthesis and secretion
    18797 (Plcb3)
   04927 Cortisol synthesis and secretion
    18797 (Plcb3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18797 (Plcb3)
   04270 Vascular smooth muscle contraction
    18797 (Plcb3)
  09154 Digestive system
   04970 Salivary secretion
    18797 (Plcb3)
   04971 Gastric acid secretion
    18797 (Plcb3)
   04972 Pancreatic secretion
    18797 (Plcb3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18797 (Plcb3)
  09156 Nervous system
   04724 Glutamatergic synapse
    18797 (Plcb3)
   04725 Cholinergic synapse
    18797 (Plcb3)
   04728 Dopaminergic synapse
    18797 (Plcb3)
   04726 Serotonergic synapse
    18797 (Plcb3)
   04720 Long-term potentiation
    18797 (Plcb3)
   04730 Long-term depression
    18797 (Plcb3)
   04723 Retrograde endocannabinoid signaling
    18797 (Plcb3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18797 (Plcb3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18797 (Plcb3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18797 (Plcb3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18797 (Plcb3)
   05016 Huntington disease
    18797 (Plcb3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18797 (Plcb3)
   04934 Cushing syndrome
    18797 (Plcb3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18797 (Plcb3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18797 (Plcb3)
   05142 Chagas disease (American trypanosomiasis)
    18797 (Plcb3)
   05143 African trypanosomiasis
    18797 (Plcb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18797 (Plcb3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18797 (Plcb3)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18797 (Plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18797 (Plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154
Motif
Other DBs
NCBI-GeneID: 18797
NCBI-ProteinID: NP_001277278
MGI: 104778
Ensembl: ENSMUSG00000024960
UniProt: P51432
LinkDB All DBs
Position
19 A; 19 5.1 cM
AA seq 1234 aa AA seqDB search
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDTRLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTVKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFPLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRSSQARLLIEKYETNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSMDMTQPLSAYFINSSHNTYLTAGQLAGPSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAEAAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLSAGIPLPSPQDLMGRILVKNKKRHRPSTGVPDS
SVRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKTSLEPQKSLGE
ESLSREPNVPMPDRDREDEEEDEEEEETTDPKKPTTDEGTASSEVNATEEMSTLVNYVEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDLPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDKKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASTETYQETPCQQ
PGSQLPSNPTPNPLDASPRWPPGPTTSSTSSSLSSPGQRDDLIASILSEVTPTPLEELRS
HKAMVKLRSRQDRDLRELHKKHQRKAVALTRRLLDGLAQARAEGKCRPSPSALGKATNSE
DVKEEEEAKQYREFQNRQVQSLLELREAQADVETKRKLEHLRQAHQRLKEVVLDTHTTQF
KRLKELNEREKKELQKILDRKRNNSISEAKTREKHKKEVELTEINRRHITESVNSIRRLE
EAQKQRHERLVAGQQQVLQQLEEEEPKLLAQLTQECQEQRERLPQEIRRCLLGETAEGLG
DGPLVACASNGHAPGSGGHLSSADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgaggcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggaggcctccagtcggaacctg
gtgaccctgcgtgtggaccctaatggcttcttcttgtactggacaggacccaacatggag
gtggacacactggacatcagctccatcagggacacaaggacaggtcgttatgcccgcctg
cccaaggaccctaagattcgagaagtactgggctttggaggtcctgacacccggctggag
gagaaactgatgacagtggtggccgggccagatccagtaaataccacattcttgaacttc
atggccgtgcaagatgacacagtcaaggtctggtcagaggagttgtttaaactggccatg
aacatattggctcagaacgcctcccggaacaccttcctgcggaaagcatacacgaagctg
aagctgcaggtgaaccaggatggacggattccggtcaagaacattctgaagatgttctcg
gcggacaagaagcgggtggagacggcgctggagtcctgtggcctcaacttcaaccgaagt
gagtccattcgccctgatgagtttcccttggaaatttttgagcggttcttgaataaactg
tgtctgcgcccggatattgacaagatcctgctggagataggtgccaagggcaagccgtac
ctcactctggagcagctcatggactttatcaaccagaagcagagagacccgagactcaac
gaagtgctgtacccgccacttcggtcctcacaggctcggctgctcattgagaagtacgag
acgaacaaacagttcctggagcgcgaccagatgtctatggagggcttcagccgctacctg
ggaggggaggagaatggtatcctgcctctggaggccctggatctgagcatggacatgacc
cagccactgagcgcatattttatcaactcctcacacaacacctatctcactgcgggccag
ctggctggaccatcatcggtggagatgtaccgccaggcactgctgtggggctgccgctgt
gtggagctggatgtatggaagggacggccaccggaggaagagcctttcatcactcatggt
ttcaccatgaccactgaggtgccattgcgtgatgtgctagaggccatcgctgaggcagcc
ttcaagacctcgccctaccctgtcatcctctcctttgagaaccatgtcgactcggcaaag
cagcaggccaagatggctgagtactgccgctctatctttggggatgcgctgctcattgac
cctctcgacaaatacccgctatctgcgggcatccccctgcctagtccacaggacctgatg
ggccgtatcctggtgaagaataagaagcgacatcggcccagcacaggtgtccctgacagc
tcagtgcgcaagcggcctctggaacagagcaactcggccttgagtgagagctcggccgcc
acagagccctcctcacctcagcttgggtcccccagctccgacagctgccctggcctaagc
aatggggaggaggtgggactcgagaagaccagcctggagcctcagaagtctctaggtgag
gagagcctcagccgggaacctaatgtgcccatgcctgaccgtgaccgagaggatgaggag
gaagatgaagaagaagaggaaacaacggatccaaaaaagcccaccactgatgagggcaca
gccagcagtgaggtcaatgccacggaggagatgtcaacgctcgtcaactacgttgagccc
gtcaagttcaagtccttcgaggctgctcgaaaaaggaacaagtgcttcgagatgtcatcc
ttcgtggagaccaaggcaatggagcaactgaccaagagtcctatggagtttgtggaatac
aacaaacagcagctcagccgcatctaccctaagggcacacgagtggactcctccaactac
atgcctcagctcttctggaacgtgggttgccagcttgttgccctcaacttccagaccttg
gatttgccaatgcagctcaacgcaggcgtgtttgagtacaatgggcgcagcgggtacttg
ctcaagcccgagtttatgcggcggccggacaagtcttttgatcccttcactgaggtcatc
gtagatggcatagtggccaacgccttgcgggtcaaggtgatttcggggcagttcctgtct
gacaagaaggtgggcatctacgtcgaggtggacatgtttggcctcccagttgacacaaga
cgcaaatatcgtacccggacatcccaggggaactcattcaaccctgtgtgggacgaggaa
ccctttgacttccccaaggttgtgctgcccacgctggcctcacttcgcatcgcagccttt
gaggagggtggcaaatttgttgggcaccgtatcctgcctgtctctgctatccgctcagga
taccactatgtctgcctgcgaaacgaggccaaccaacctttgtgcctgcctgccctgctt
atctacactgaagcttctgactacatcccagatgaccaccaggactatgcggaggccttg
attaaccccatcaagcacgtaagcctaatggaccagcgggccaagcaactagccgctctc
attggggagagtgaggctcaggccagcacagagacatatcaggagaccccgtgtcaacag
ccagggtcacagctcccctccaaccccacacctaacccactggatgcctcacctcgctgg
ccccccggtcctaccacttcctccactagctcctccctcagtagcccagggcagcgagat
gatttgattgccagcatcctctctgaggtgacccctacacctctagaggagctcagaagc
cacaaggctatggtgaagctacggagccggcaggatcgagacctgcgggagttgcataag
aagcaccagcgcaaggctgtggccctcacccgccgccttctggatggcctggcccaggcc
agggctgaggggaagtgccggccctcccccagtgccctgggcaaggccaccaactcggag
gacgtgaaggaggaagaggaggccaaacagtatcgagagttccagaaccgacaagtacag
agcctgttggagctgagggaagcccaggcagatgtggagaccaagcggaagctggagcat
ctacgacaggctcatcagcggctcaaggaggttgtcctggatacacacacaacacagttc
aagaggctgaaggagctgaatgaaagggagaagaaggaactccagaagatcctggacagg
aagcgcaacaacagcatctcagaggccaagacaagggagaaacacaagaaggaggtggaa
ctgacagagattaatcggcggcacatcactgagtcggtaaactccatcagacggctggaa
gaggcccagaagcagcgccatgaacgcctggtggcagggcaacagcaagtcctccagcag
ctagaggaagaggaacccaagctgctggcccagctgacccaggagtgtcaggaacagcga
gagaggttgccccaggagatccgtcggtgcctgctgggcgagacagcagagggactgggg
gacggccccctggtggcctgtgccagcaatggtcatgcacctgggagtggtgggcacctg
tccagcgctgactcggagagccaggaggagaacacccagctttga

KEGG   Mus musculus (mouse): 18798Help
Entry
18798             CDS       T01002                                 

Gene name
Plcb4, A930039J07Rik, AI854601, C230058B11Rik
Definition
(RefSeq) phospholipase C, beta 4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04062  Chemokine signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04310  Wnt signaling pathway
mmu04371  Apelin signaling pathway
mmu04540  Gap junction
mmu04611  Platelet activation
mmu04621  NOD-like receptor signaling pathway
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04916  Melanogenesis
mmu04918  Thyroid hormone synthesis
mmu04919  Thyroid hormone signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04926  Relaxin signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04929  GnRH secretion
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04934  Cushing syndrome
mmu04961  Endocrine and other factor-regulated calcium reabsorption
mmu04970  Salivary secretion
mmu04971  Gastric acid secretion
mmu04972  Pancreatic secretion
mmu05010  Alzheimer disease
mmu05016  Huntington disease
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05146  Amoebiasis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18798 (Plcb4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    18798 (Plcb4)
   04310 Wnt signaling pathway
    18798 (Plcb4)
   04371 Apelin signaling pathway
    18798 (Plcb4)
   04020 Calcium signaling pathway
    18798 (Plcb4)
   04070 Phosphatidylinositol signaling system
    18798 (Plcb4)
   04072 Phospholipase D signaling pathway
    18798 (Plcb4)
   04071 Sphingolipid signaling pathway
    18798 (Plcb4)
   04022 cGMP-PKG signaling pathway
    18798 (Plcb4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    18798 (Plcb4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    18798 (Plcb4)
   04621 NOD-like receptor signaling pathway
    18798 (Plcb4)
   04062 Chemokine signaling pathway
    18798 (Plcb4)
  09152 Endocrine system
   04911 Insulin secretion
    18798 (Plcb4)
   04922 Glucagon signaling pathway
    18798 (Plcb4)
   04929 GnRH secretion
    18798 (Plcb4)
   04912 GnRH signaling pathway
    18798 (Plcb4)
   04915 Estrogen signaling pathway
    18798 (Plcb4)
   04921 Oxytocin signaling pathway
    18798 (Plcb4)
   04926 Relaxin signaling pathway
    18798 (Plcb4)
   04918 Thyroid hormone synthesis
    18798 (Plcb4)
   04919 Thyroid hormone signaling pathway
    18798 (Plcb4)
   04928 Parathyroid hormone synthesis, secretion and action
    18798 (Plcb4)
   04916 Melanogenesis
    18798 (Plcb4)
   04924 Renin secretion
    18798 (Plcb4)
   04925 Aldosterone synthesis and secretion
    18798 (Plcb4)
   04927 Cortisol synthesis and secretion
    18798 (Plcb4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    18798 (Plcb4)
   04270 Vascular smooth muscle contraction
    18798 (Plcb4)
  09154 Digestive system
   04970 Salivary secretion
    18798 (Plcb4)
   04971 Gastric acid secretion
    18798 (Plcb4)
   04972 Pancreatic secretion
    18798 (Plcb4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    18798 (Plcb4)
  09156 Nervous system
   04724 Glutamatergic synapse
    18798 (Plcb4)
   04725 Cholinergic synapse
    18798 (Plcb4)
   04728 Dopaminergic synapse
    18798 (Plcb4)
   04726 Serotonergic synapse
    18798 (Plcb4)
   04720 Long-term potentiation
    18798 (Plcb4)
   04730 Long-term depression
    18798 (Plcb4)
   04723 Retrograde endocannabinoid signaling
    18798 (Plcb4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18798 (Plcb4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    18798 (Plcb4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18798 (Plcb4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    18798 (Plcb4)
   05016 Huntington disease
    18798 (Plcb4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18798 (Plcb4)
   04934 Cushing syndrome
    18798 (Plcb4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    18798 (Plcb4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    18798 (Plcb4)
   05142 Chagas disease (American trypanosomiasis)
    18798 (Plcb4)
   05143 African trypanosomiasis
    18798 (Plcb4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18798 (Plcb4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18798 (Plcb4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18798 (Plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18798 (Plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 18798
NCBI-ProteinID: NP_001342082
MGI: 107464
Ensembl: ENSMUSG00000039943
Vega: OTTMUSG00000015959
LinkDB All DBs
Structure
PDB: 

Position
2 F3; 2 66.64 cM
AA seq 1194 aa AA seqDB search
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRQAAIPKDPKILAALEAVGKSENDLEGRILCVCSGTDLVNIGFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFLTNTTGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEELKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPASILEDDNEEEIESADQEEEAHPEYKFGNELSADDYSHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANPAKANVTPQSSSELRPTTTAA
LGSGQEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEIKKETEIKIQTLTTDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQSAN
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atggccaaaccttacgaatttaactggcagaaggaagtgccctctttcttgcaagaagga
gcagtttttgacagatacgaagaggaatcttttgtgtttgagcccaactgcctcttcaaa
gtagatgaattcggcttcttcctgacgtggaagagtgaaggcaaggaaggacaagtgcta
gaatgttccctcatcaacagtattcgccaagcagccataccaaaggatcccaaaatcctg
gctgctctcgaagctgttggaaaatctgaaaatgatctggaagggcggatattgtgtgtc
tgcagcggcacggatctggtgaatatcggcttcacttacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcgatcattcacaacttcagggcaaacaac
gtcagtccgatgacatgcctcaagaaacactggatgaaactggcctttctgaccaacaca
actggtaaaatcccagtgaggagtatcactagaaccttcgcatcagggaaaacagaaaag
gtgatctttcaagccctcaaggaactaggtcttcccagtggaaagaatgatgaaattgaa
cctgctgcatttacttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatctttttaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaacgaacatcagcgagatcctcggctgaatgaaattttattc
ccattttatgatgctaaaagagcaatgcagatcattgaaatgtatgagcctgatgaagag
ctgaagaaaaaaggcctcatatccagtgatggattctgcagatatctgatgtcagatgaa
aatgcccctgtcttcttagatcgcttagaactttaccaggagatggaccacccgctggct
cattacttcatcagttcctcccacaacacctatctcactggccggcaatttggaggaaag
tcttcagtggaaatgtacagacaagttctcctggctggttgcaggtgtgttgaacttgac
tgttgggatggaaaaggtgaagatcaggaaccgataataactcacggaaaagcaatgtgt
acagacatcctttttaaggatgtaatccaggccatcaaggaaacggcgtttgtcacatca
gaataccctgtcattctctccttcgaaaaccactgcagcaaatatcaacagtacaagatg
tccaagtattgtgaagatctatttggggatctcctgttgaaacaagcacttgagtcgcat
ccacttgaaccaggaaggcccttgccgtctcctaatgacctcaaaagaaaaatactcatc
aagaataagaggctgaagcctgaagttgaaaagaaacagcttgaagctttgaaaagcatg
atggaagctggagagtcagccgccccagctagcatcttggaagacgacaatgaagaggaa
atagaaagtgctgatcaagaggaagaagcccaccctgaatacaaatttggaaatgaactt
tctgccgatgactacagtcacaaggaagcggttgcaaacagcgtcaagaagggcctggtc
accgtagaggatgagcaagcatggatggcatcttataaatacgtaggtgctaccacgaac
atccatccgtacttgtccacgatgatcaactatgcccagcccgtgaagtttcaaggtttc
cacgtggctgaagagcgcaatattcactataacatgtcttcttttaacgagtcggttggc
cttggctacttgaagacgcacgcgattgagtttgtaaattacaataagcgacaaatgagc
cgcatttaccccaagggaggccgagttgattccagtaattacatgcctcagattttctgg
aacgctggttgccagatggtttcactgaactatcaaaccccagatttagcgatgcaattg
aatcaaggaaaatttgagtataatggatcatgcgggtaccttctcaagccagatttcatg
aggcggcctgatcggacatttgaccccttctctgaaacccctgtggacggggttattgca
gccacgtgctcagtgcaggttatatcagggcagttcctctcagataagaagatcgggaca
tacgtggaagtcgatatgtacgggctgcccaccgacaccatacggaaagagttccgaacc
cgcatggttatgaacaatggactcaacccagtgtataatgaagaatcgtttgtgtttcga
aaggtgatcctgcctgacctagctgtcctgagaatcgcagtctacgatgacaacaacaag
ctaattggccagaggatccttcctttggatggtctccaagcaggctaccgacacatctcc
ctgagaaacgagggaaacaaaccattatcactgccaacaattttctgcaatattgttctt
aaaacatacgtgcctgatggatttggagatattgtggatgctttatccgatccaaagaaa
tttctttcaatcacagagaagagagcagaccaaatgagagcaatgggcattgaaactagt
gacatagcagatgtgcccagtgacacttccaaaaatgacaagaaaggcaaggccaaccca
gccaaagcgaacgtgacccctcagagcagctctgagctcagaccaaccaccacagccgcc
ctgggctctggccaggaagccaagaaaggtattgaacttatccctcaagtgaggatagaa
gatttaaagcaaatgaaggcttacttgaagcatttaaagaaacaacagaaggagttaaac
tctttaaagaagaaacatgcaaaggagcacagtaccatgcagaagttacactgcacacaa
gttgacaaaatcgtggcccagtatgacaaagagaagtcgactcatgagaaaatcctagag
aaggcgatgaagaagaaggggggaagtaattgtcttgaaataaaaaaagaaacagaaatt
aaaattcagaccctgacaacggatcacaaatctaaggtcaaagagattgtggcccagcac
acaaaggagtggtcagaaatgatcaacactcacagtgcggaggagcaggaaatccgggat
ctgcacctgagccagcagtgtgagctgctgagaaagctgctcatcaatgctcatgagcag
cagacccagcagctgaaactctcccatgacagggaaagcaaggagatgagagcccatcag
gctaagatttctatggaaaatagcaaggccatcagtcaagataaatctatcaagaacaag
gcagaacgggaaaggcgagtcagggagttgaacagcagcaacactaagaagttcctagaa
gaaagaaagagactggcgatgaagcagtcaaaagaaatggatcagttgaaaaaagtccag
ctggagcacctagaattcctagagaaacagaacgagcagcttttgaaatcctgtcatgca
gtgtcccaaacacaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagtagtatgaaactccagagtgcaaactga

DBGET integrated database retrieval system