KEGG   Mus musculus (mouse): 18803Help
Entry
18803             CDS       T01002                                 

Gene name
Plcg1, AI894140, Cded, Plc-1, Plc-gamma1, Plcg-1
Definition
(RefSeq) phospholipase C, gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04072  Phospholipase D signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu04670  Leukocyte transendothelial migration
mmu04722  Neurotrophin signaling pathway
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04919  Thyroid hormone signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05135  Yersinia infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05223  Non-small cell lung cancer
mmu05225  Hepatocellular carcinoma
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
mmu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    18803 (Plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18803 (Plcg1)
   04015 Rap1 signaling pathway
    18803 (Plcg1)
   04012 ErbB signaling pathway
    18803 (Plcg1)
   04370 VEGF signaling pathway
    18803 (Plcg1)
   04064 NF-kappa B signaling pathway
    18803 (Plcg1)
   04066 HIF-1 signaling pathway
    18803 (Plcg1)
   04020 Calcium signaling pathway
    18803 (Plcg1)
   04070 Phosphatidylinositol signaling system
    18803 (Plcg1)
   04072 Phospholipase D signaling pathway
    18803 (Plcg1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    18803 (Plcg1)
   04660 T cell receptor signaling pathway
    18803 (Plcg1)
   04658 Th1 and Th2 cell differentiation
    18803 (Plcg1)
   04659 Th17 cell differentiation
    18803 (Plcg1)
   04664 Fc epsilon RI signaling pathway
    18803 (Plcg1)
   04666 Fc gamma R-mediated phagocytosis
    18803 (Plcg1)
   04670 Leukocyte transendothelial migration
    18803 (Plcg1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    18803 (Plcg1)
   04919 Thyroid hormone signaling pathway
    18803 (Plcg1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18803 (Plcg1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    18803 (Plcg1)
  09158 Development and regeneration
   04360 Axon guidance
    18803 (Plcg1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18803 (Plcg1)
   05206 MicroRNAs in cancer
    18803 (Plcg1)
   05205 Proteoglycans in cancer
    18803 (Plcg1)
   05231 Choline metabolism in cancer
    18803 (Plcg1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18803 (Plcg1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18803 (Plcg1)
   05214 Glioma
    18803 (Plcg1)
   05223 Non-small cell lung cancer
    18803 (Plcg1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    18803 (Plcg1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18803 (Plcg1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    18803 (Plcg1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18803 (Plcg1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18803 (Plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    18803 (Plcg1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     18803 (Plcg1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    18803 (Plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    18803 (Plcg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 18803
NCBI-ProteinID: NP_067255
MGI: 97615
Ensembl: ENSMUSG00000016933
Vega: OTTMUSG00000001177
UniProt: Q62077
LinkDB All DBs
Position
2 H2; 2 80.97 cM
AA seq 1302 aa AA seqDB search
MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLETNALRT
GERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDELVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLRRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASS
STELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQDGGWWRGDYGGKKQLW
FPSNYVEEMINPAVLEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MPSVAQWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCVICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGISLRERASDASSQLFHVRAREGSFEARYQQPFEDF
RISQEHLADHFDSRERSTSDGPSSATNLIEDPLHDKLWKCSL
NT seq 3909 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgtcgcgaccccctgcgccaacggctgcgggcctggcgcaccctccgaagcc
gaggtgctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggccagaacggaagaccttccaggtcaagttggagacgcgccagatc
acatggagccgcggcgcggacaaaatcgaggggtccattgatatccgagaaatcaaggag
atccgtccagggaagacttctcgggactttgaccgctaccaagaagaccctgccttccgg
ccagatcaatcacactgctttgtcatcctctatggaatggaattccgcttgaagaccctg
agcctgcaagccacatctgaggatgaagtgaacatgtggatcaagggcttaacttggcta
atggaggatacactgcaggcagccacacccctgcaaattgagaggtggctccggaagcag
ttctactcagtggatcgtaaccgagaggatcgtatatcagccaaggacttgaagaacatg
ctgtctcaggtcaactaccgagtccccaatatgcgcttcctccgagagcggctgacggac
cttgaacagcgcagcggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggaccttcccttcttggaaaccaacgctttgaggact
ggagagcgtccggagcattgccaggtgtccctttctgagttccagcagttcctccttgaa
taccagggggagctgtgggctgtcgaccggctccaggtgcaggaattcatgctcagcttc
cttcgagaccccttgcgagagattgaggagccatacttcttcttggatgagcttgtcacc
ttcctgttctccaaagagaacagcgtgtggaactcacagctggatgctgtgtgcccggac
accatgaacaacccactctctcactattggatctcctcctcacataatacgtacctgact
ggggaccagttctccagtgagtcctccctggaagcctatgctcgctgcctgaggatgggc
tgtcgctgcattgagttggactgctgggatgggccagatgggatgccagtcatttaccat
gggcacactctcaccaccaagatcaagttctctgacgtcctgcacaccatcaaggagcat
gctttcgtagcctcagagtacccagtcatcctgtccatcgaggaccactgcagcattgcc
cagcagagaaacatggctcagcacttcagaaaggtgcttggcgacacactccttaccaag
cctgtggacattgctgctgatggccttccttctcccaaccagctcaggaggaagatcctt
attaagcacaagaagctggctgagggcagtgcctatgaggaggtgcctacctctgtgatg
tactccgagaatgacatcagtaactccatcaagaatggtatcctctacttggaggacccc
gtgaatcatgagtggtatccccactacttcgttctgactagcagcaagatctactactct
gaggagaccagcagtgaccagggcaatgaggatgaagaggagccgaaggaggccagcagc
agcacagagctgcactcgagtgagaagtggttccacgggaagctcggggctggacgtgac
gggcggcacattgctgagcgcctgctcactgagtactgcatagagactggggctcctgat
ggctccttcctagtgcgagaaagtgagaccttcgtgggtgactacacgctgtctttctgg
cggaatgggaaagtccagcactgccgcatccactcccggcaggatgctgggactcctaag
ttcttcttgacagataaccttgtctttgactctctctatgacctcatcacacattatcag
caagtacccctgcgctgcaatgagtttgagatgcgcctttcagagcctgttccacagacg
aatgcccatgagagcaaagagtggtaccacgcaagcctgactagagctcaggctgaacat
atgctgatgcgagtgccccgggatggggccttcctggtgcggaaacgcaatgagcctaac
tcatatgccatctctttccgggctgagggaaagatcaagcactgccgagtacagcaggaa
ggccagacagtgatgctggggaactctgagtttgacagcctggttgacctcatcagctac
tatgagaagcaccccctgtaccgcaaaatgaagctacgctaccccatcaacgaggaggca
ctggagaagatcgggacagctgaacccgattatggggcactatacgagggccgcaaccct
ggtttctatgtggaggcaaaccctatgccaactttcaagtgtgcagtaaaagccctcttc
gactacaaggcccagagagaggatgagctgaccttcaccaagagtgccatcatccagaat
gtggaaaagcaagatggtggctggtggcgaggggactatggtgggaagaagcagctgtgg
ttcccctcaaactatgtggaagagatgatcaatccagcagtcctagagcctgagagggag
cacctggatgagaacagcccactgggggacttgctgcgaggggtcttagatgtgccagct
tgtcagatcgccatccgtcctgagggcaaaaacaaccggctcttcgtcttctccatcagc
atgccatcagtggctcagtggtccctggatgttgcagctgactcacaggaggagttacag
gactgggtgaaaaagatccgtgaagttgcccagactgcagatgccaggctcactgaggga
aagatgatggagaggaggaagaagatcgccttggagctctccgagcttgtggtctactgc
cggcccgttccctttgatgaagagaagattggcacagaacgtgcttgttaccgggacatg
tcctcctttccggaaaccaaggctgagaagtatgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccggctgcagctctcgcgcatctaccctaagggccagaggctagactcc
tccaattatgaccctctgcccatgtggatctgcggtagccagcttgtagcactcaatttc
cagaccccagacaagcctatgcagatgaaccaggccctcttcatggctggtgggcattgt
ggctatgtgctgcagccaagcaccatgagagacgaagcctttgacccctttgataagagc
agtctccgaggtctggaaccctgtgtcatttgcattgaggtgctgggggccaggcatctg
ccgaagaatggccggggtattgtgtgtccttttgtggagattgaggtggctggggctgag
tacgacagcaccaagcaaaagacggagtttgtagtggacaacggactgaaccctgtgtgg
cctgctaagcccttccacttccagatcagtaacccagagtttgcctttctgcgctttgtg
gtgtatgaggaagacatgtttagtgaccagaacttcttggctcaggctactttcccagta
aaaggcctgaagacaggatatagagcagtgcctttgaagaacaactacagtgaagacctg
gagttggcctccctgctcatcaagattgacattttccctgctaaggagaacggtgacctc
agtcctttcagtggcatatccctaagggaacgggcctcagatgcctccagccagctgttc
catgtccgggcccgggaagggtcctttgaagccagataccagcagccatttgaagatttc
cgcatctcgcaggagcatctagcagaccattttgacagtcgggaacgaagtacttcagat
ggtccttcctcagccactaaccttattgaggatcccttacatgacaagctgtggaagtgc
tctctttaa

DBGET integrated database retrieval system