KEGG   Mus musculus (mouse): 18854Help
Entry
18854             CDS       T01002                                 

Gene name
Pml, 1200009E24Rik, AI661194, Trim19
Definition
(RefSeq) promyelocytic leukemia
  KO
K10054  probable transcription factor PML
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu05164  Influenza A
mmu05168  Herpes simplex virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    18854 (Pml)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    18854 (Pml)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18854 (Pml)
   05202 Transcriptional misregulation in cancer
    18854 (Pml)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    18854 (Pml)
  09172 Infectious disease: viral
   05164 Influenza A
    18854 (Pml)
   05168 Herpes simplex virus 1 infection
    18854 (Pml)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    18854 (Pml)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    18854 (Pml)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3583 zf-B_box BMFP zf-C3HC4_3 Prok-RING_4 zf-RING_UBOX zf-RING_5 OmpH
Motif
Other DBs
NCBI-GeneID: 18854
NCBI-ProteinID: NP_835188
MGI: 104662
Ensembl: ENSMUSG00000036986
Vega: OTTMUSG00000033332
UniProt: Q60953 A0A068EW80 Q8BSJ6
LinkDB All DBs
Position
9 B; 9 31.63 cM
AA seq 885 aa AA seqDB search
METEPVSVQKVPAPPGSPCRQQDSALTPTPTMPPPEEPSEDYEHSQSPAEQAIQEEFQFL
RCPSCQAQAKCPKLLPCLHTLCSGCLEAPGLQCPICKAPGQADANGEALDNVFFESLQRR
LAVFRQIVDAQAACTRCKGLADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDNSVS
SFLDSTRKSNIFCSNTNHRNPALTDIYCRGCAKPLCCTCALLDRNHSHLHCDIGEEIQQW
HEELGTMTQTLEEQGRTFDSAHAQMCSAIGQLDHARADIEKQIRARVRQVVDYVQAQERE
LLEAVNDRYQRDYQEIAGQLSCLEAVLQRIRTSGALVKRMKLYASDQEVLDMHSFLRKAL
CSLRQEEPQNQKVQLLTRGFEEFKLCLQDFISCITQRINAAVASPEAASNQPEAASTHPV
TTSTPEDLEQPKEVQSVQAQALELSKTQPVAMVKTVPGAHPVPVYAFSMQGPTYREEASQ
TVGSMKRKCSHEDCSRKIIKMESTEENEDRLATSSPEQSWPSTFKATSPPHLDGTSNPES
TVPEKKILLPNNNHVTSDTGETEERVVVISSSEDSDTENLSSHELDDSSSESSSLQLEGP
NSLKALDESLAEPHLEDRTLVFFDLKIDNETQKISQLAAVNRESKFRVLIQPEAFSVYSK
AVSLEAGLRHFLSFLTTMHRPILACSRLWGPGLPIFFQTLSDINKLWEFQDTISGFLAVL
PLIRERIPGASSFKLGNLAKTYLARNMSERSALASVLAMRDLCCLLEISPGLPLAQHIYS
FSSLQCFASLQPLIQASVLPQSEARLLALHNVSFVELLNAYRTNRQEGLKKYVHYLSLQT
TPLSSSASTQVAQFLQALSTHMEGLLEGHAPAGAEGKAESKGCLA
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgaaccagtttccgtgcagaaggtacctgcaccccctggatctccctgtcga
caacaggactctgccctgacccccacgcccaccatgcctcccccagaggaaccctccgaa
gactatgaacacagccaaagccctgcagagcaagccatacaggaggaatttcagtttctg
cgctgcccgagctgccaggcccaagccaagtgccccaaactgctgccttgcctgcacacg
ctgtgctccggatgcctggaggcgcctggcctgcagtgccccatctgcaaggctcctggg
caggccgatgctaatggggaggccctggataacgtgttcttcgagagcctgcagcggcgc
ctggcggtgttccggcagatcgtggatgctcaggctgcgtgcacccgctgcaaaggcttg
gccgacttctggtgtttcgagtgtgaacagctcatttgcagcaagtgcttcgaagcacac
cagtggtacctcaagcatgaggcccggcccctggctgatctccgcgacaattcagtgagc
agcttcctcgacagtacgcgcaagtccaatatcttctgctccaataccaaccaccgcaac
cctgcgctgactgacatctactgccgaggctgcgccaagcctctgtgttgcacatgcgcg
ctcctggaccgcaaccacagccatctccattgcgatattggtgaggagattcagcagtgg
catgaggaactaggcaccatgacacagactctggaggagcagggcagaaccttcgacagt
gcccatgcacagatgtgctcagctataggacagctggaccacgcacgcgcagacattgag
aagcagatccgcgcacgcgtgcgccaggtggtagactacgtgcaggctcaggagcgcgag
ctgctcgaggcggtgaatgaccgctaccagcgcgactaccaggaaatagctggccagctg
agctgcctggaagctgtgctgcagcgcatccgcactagtggggcgctggtcaagaggatg
aagctctatgcctccgaccaggaggtgctggatatgcacagctttctgcgcaaggcactc
tgtagcttgcgccaggaggagccccagaaccagaaagtccagctgctcaccagaggtttc
gaggagttcaagctgtgcctgcaggacttcatctcctgcatcacccagaggataaatgca
gctgtagccagcccagaggcagccagcaatcaaccagaggcagccagcactcacccagtg
acaaccagcacgcctgaggaccttgagcagcccaaagaagtgcagagtgtacaggctcag
gccctagagctgtctaagacccaacctgtggctatggtaaaaacagtgcctggagcacac
cctgtaccagtgtatgccttttcaatgcaaggccccacctacagagaggaggcttctcag
acagtcggctccatgaagaggaagtgctcccacgaagattgctccaggaagatcatcaag
atggagtccacagaggagaacgaggacaggttggccacaagctcccccgagcagtcctgg
cccagcactttcaaggccacctcccctccccatctggatgggacttccaaccctgagagc
accgtccctgaaaaaaagatcctcctgcccaacaacaatcatgttaccagtgacacaggg
gaaacagaggagcgagttgtggtgatcagcagctcagaggattcggacaccgagaatctg
tcctcccacgagttggacgatagcagcagtgagtccagcagcctgcagctggagggcccc
aattccctcaaggccttggatgagagcctcgccgaaccccacttagaagacaggaccctg
gttttctttgacctcaagattgacaatgaaacccagaaaattagccagctggccgcggtg
aaccgggaaagcaagttccgtgtgctcatccagcccgaggccttcagtgtctactccaaa
gctgtctccctggaggcggggctccggcacttcctcagcttcctcaccaccatgcaccgt
cccatcttggcgtgttctaggctgtgggggccgggactccccatcttcttccagaccctg
agtgatattaacaagctgtgggaattccaggacaccatctcaggtttcttggccgtgctg
cccctcatccgggaacgcatacccggcgctagcagcttcaaacttgggaacctagccaag
acctacctggcgagaaacatgagcgaacgcagcgctctggcttctgtgctggccatgagg
gacttgtgctgcctccttgagatctccccaggactgccgctggcccagcatatctactcc
tttagtagcttgcagtgttttgcttccctgcagcccctaattcaggccagcgtcctgcca
cagtccgaggcccgcctcttggccctccacaatgtgagctttgtagagttactgaatgca
tatcgcaccaacaggcaagaaggcttgaagaagtatgtccactatctgagcctgcagacc
accccgttgtcatcgtcggcttccacccaagttgcccaattcctgcaggctcttagcacc
cacatggaaggactgttggaaggccatgcccctgctggggcagaaggcaaagctgaaagt
aagggatgcctggcctag

KEGG   Mus musculus (mouse): 19401Help
Entry
19401             CDS       T01002                                 

Gene name
Rara, Nr1b1, RAR, RARalpha1
Definition
(RefSeq) retinoic acid receptor, alpha
  KO
K08527  retinoic acid receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04659  Th17 cell differentiation
mmu04915  Estrogen signaling pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    19401 (Rara)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    19401 (Rara)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19401 (Rara)
   05202 Transcriptional misregulation in cancer
    19401 (Rara)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    19401 (Rara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19401 (Rara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19401 (Rara)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    19401 (Rara)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   19401 (Rara)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 19401
NCBI-ProteinID: NP_001170773
MGI: 97856
Ensembl: ENSMUSG00000037992
Vega: OTTMUSG00000006440
UniProt: P11416 Q3U3R3
LinkDB All DBs
Position
11 D; 11 62.76 cM
AA seq 462 aa AA seqDB search
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTSLQHQLPVSGYSTPSPAT
IETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCIINKVTRNRCQYCRLQKCFDVGMSKESVRNDRNKKKKEAPKPECSESYTL
TPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTV
EFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALK
VYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGL
DTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaatagcagttcctgcccaacacctgggggcgggcacctcaatgggtaccca
gtacccccctacgccttcttctttccccctatgctgggtggactctccccacccggcgct
ctcaccagcctccagcaccagcttccagtcagtggttacagcacaccgtccccagccacc
atcgagacccagagcagcagttccgaagagatagtacccagccctccctcaccaccgccc
ctgccccgcatctacaagccttgctttgtttgtcaagacaaatcatccggctaccactat
ggggtcagcgcctgtgagggctgtaagggcttcttccgacgaagcatccagaagaacatg
gtgtatacgtgtcaccgggacaagaactgcatcatcaacaaggtgacccggaaccgctgc
cagtactgccggctgcagaaatgtttcgacgtgggcatgtccaaggagtcggtgcgaaac
gatcgaaacaaaaagaagaaagaggcacccaagcccgagtgctcagagagctacacgctg
acgcctgaggtgggcgagctcattgagaaggttcgcaaagcgcaccaggagaccttcccg
gccctctgccagctgggcaagtacactacgaacaacagctcagaacaacgagtctccctg
gacattgacctctgggacaagttcagtgaactctccaccaagtgcatcattaagactgtg
gagttcgccaagcagcttcccggcttcaccaccctcaccatcgccgaccagatcaccctc
ctcaaggctgcctgcctggatatcctgattctgcgaatctgcacgcggtacacgcctgag
caagacacaatgaccttctcagatggactgaccctgaaccggactcagatgcacaacgct
ggctttggccccctcaccgacttggtctttgccttcgccaaccagctgctgcccctggag
atggacgatgctgagactggactgctcagtgccatctgcctcatctgtggagaccgacag
gacctggagcagccagacaaggtggacatgctgcaagagccgctgctggaagcactgaaa
gtctacgtccggaaacggaggcccagccgaccccacatgttccccaagatgctgatgaag
atcacagaccttcggagcatcagcgccaagggagctgaacgggtgatcacattgaagatg
gagatcccaggctccatgccaccgctgatccaggaaatgctggagaactctgagggcttg
gacactctaagcggacagtcggggggcggaacacgagatgggggtggcctggccccccct
ccgggtagctgtagccccagcctcagtcccagctcccacagaagcagcccagccacccaa
tccccatga

DBGET integrated database retrieval system