KEGG   Mus musculus (mouse): 19015Help
Entry
19015             CDS       T01002                                 

Gene name
Ppard, NUC-1, NUC1, Nr1c2, PPAR-beta, PPAR-delta, PPAR[b], PPARdelta, Pparb, Pparb/d
Definition
(RefSeq) peroxisome proliferator activator receptor delta
  KO
K04504  peroxisome proliferator-activated receptor delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04310  Wnt signaling pathway
mmu05200  Pathways in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    19015 (Ppard)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    19015 (Ppard)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19015 (Ppard)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    19015 (Ppard)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19015 (Ppard)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19015 (Ppard)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    19015 (Ppard)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   19015 (Ppard)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 19015
NCBI-ProteinID: NP_035275
MGI: 101884
Ensembl: ENSMUSG00000002250
Vega: OTTMUSG00000023384
UniProt: P35396 Q546I3
LinkDB All DBs
Position
17 A3.3; 17 14.64 cM
AA seq 440 aa AA seqDB search
MEQPQEETPEAREEEKEEVAMGDGAPELNGGPEHTLPSSSCADLSQNSSPSSLLDQLQMG
CDGASGGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCDRICKIQKKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGCQHNPQLADLKAFSKH
IYNAYLKNFNMTKKKARSILTGKSSHNAPFVIHDIETLWQAEKGLVWKQLVNGLPPYNEI
SVHVFYRCQSTTVETVRELTEFAKNIPNFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGSGFVTHEFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVPQVEAIQDTILRALEFHLQVNHPDSQYLFPKLLQKMADLRQLVTEHAQMMQWLK
KTESETLLHPLLQEIYKDMY
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaacagccacaggaggagacccctgaggcccgggaagaggagaaagaggaagtggcc
atgggtgacggagccccggagctcaatgggggaccagaacacacgcttccttccagcagc
tgtgcagacctctcccagaattcctccccttcctccctgctggaccagctgcagatgggc
tgtgatggggcctcaggcggcagcctcaacatggaatgtcgggtgtgcggggacaaggcc
tcgggcttccactacggggtccacgcgtgcgaggggtgcaagggcttcttccgccggaca
atccgcatgaagctcgagtatgagaagtgcgatcggatctgcaagatccagaagaagaac
cgcaacaagtgtcagtactgccgcttccagaagtgcctggcactcggcatgtcgcacaac
gctatccgctttggacggatgccggaggccgagaagaggaagctggtggcggggctgact
gccagcgaggggtgccagcacaacccccagctggccgacctgaaggccttctctaagcac
atctacaacgcctacctgaaaaacttcaacatgaccaaaaagaaggcccggagcatcctc
accggcaagtccagccacaacgcaccctttgtcatccacgacatcgagacactgtggcag
gcagagaagggcctggtgtggaaacagctggtgaacgggctgccgccctacaacgagatc
agtgtgcacgtgttctaccgctgccagtccaccacagtggagacagtccgagagctcacc
gagttcgccaagaacatccccaacttcagcagcctcttcctcaatgaccaggtgaccctc
ctcaagtatggcgtgcacgaggccatctttgccatgctggcctccatcgtcaacaaagac
gggctgctggtggccaacggcagtggcttcgtcacccacgagttcttgcgaagtctccgc
aagcccttcagtgacatcattgagcccaagttcgagtttgctgtcaagttcaatgcgctg
gagctcgatgacagtgacctggcgctcttcatcgcggccatcattctgtgtggagaccgg
ccaggcctcatgaatgtgccccaggtagaagccatccaggacaccattctgcgggctcta
gaattccatctgcaggtcaaccaccctgacagccagtacctcttccccaagctgctgcag
aagatggcagacctgcggcagctggtcactgagcatgcccagatgatgcagtggctaaag
aagacggagagtgagaccttgctgcaccccctgctccaggaaatctacaaggacatgtac
taa

DBGET integrated database retrieval system