KEGG   Mus musculus (mouse): 19055Help
Entry
19055             CDS       T01002                                 

Gene name
Ppp3ca, 2900074D19Rik, CN, Caln, Calna, CnA
Definition
(RefSeq) protein phosphatase 3, catalytic subunit, alpha isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19055 (Ppp3ca)
   04310 Wnt signaling pathway
    19055 (Ppp3ca)
   04370 VEGF signaling pathway
    19055 (Ppp3ca)
   04020 Calcium signaling pathway
    19055 (Ppp3ca)
   04022 cGMP-PKG signaling pathway
    19055 (Ppp3ca)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19055 (Ppp3ca)
   04218 Cellular senescence
    19055 (Ppp3ca)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19055 (Ppp3ca)
   04650 Natural killer cell mediated cytotoxicity
    19055 (Ppp3ca)
   04660 T cell receptor signaling pathway
    19055 (Ppp3ca)
   04658 Th1 and Th2 cell differentiation
    19055 (Ppp3ca)
   04659 Th17 cell differentiation
    19055 (Ppp3ca)
   04662 B cell receptor signaling pathway
    19055 (Ppp3ca)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19055 (Ppp3ca)
   04921 Oxytocin signaling pathway
    19055 (Ppp3ca)
   04924 Renin secretion
    19055 (Ppp3ca)
  09156 Nervous system
   04724 Glutamatergic synapse
    19055 (Ppp3ca)
   04728 Dopaminergic synapse
    19055 (Ppp3ca)
   04720 Long-term potentiation
    19055 (Ppp3ca)
  09158 Development and regeneration
   04360 Axon guidance
    19055 (Ppp3ca)
   04380 Osteoclast differentiation
    19055 (Ppp3ca)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19055 (Ppp3ca)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19055 (Ppp3ca)
   05014 Amyotrophic lateral sclerosis (ALS)
    19055 (Ppp3ca)
  09165 Substance dependence
   05031 Amphetamine addiction
    19055 (Ppp3ca)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19055 (Ppp3ca)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19055 (Ppp3ca)
   05170 Human immunodeficiency virus 1 infection
    19055 (Ppp3ca)
   05163 Human cytomegalovirus infection
    19055 (Ppp3ca)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19055 (Ppp3ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19055 (Ppp3ca)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19055 (Ppp3ca)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     19055 (Ppp3ca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 19055
NCBI-ProteinID: NP_032939
MGI: 107164
Ensembl: ENSMUSG00000028161
Vega: OTTMUSG00000016446
UniProt: P63328 B2RRX2
LinkDB All DBs
Structure
PDB: 

Position
3; 3 G3
AA seq 521 aa AA seqDB search
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCDFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRIN
ERMPPRRDAMPSDANLNSINKALASETNGTDSNGSNSSNIQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccaaggcgattgatcccaagttgtcgacgaccgacagggtggtgaaagcc
gttccatttccaccaagtcaccggctgacagcaaaggaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaagcacatctcatgaaggagggcaggctggaagaaagtgtt
gcattgagaataataacagagggtgcttcgattctccgacaggaaaaaaacttgctggat
atcgacgcaccagtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtgggaggatctcctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggccttgaaaattctttac
cccaaaacactgtttttacttcgcggaaaccatgaatgtaggcacctcacagagtatttc
acgtttaaacaagaatgtaaaataaagtattcagaacgcgtttatgacgcctgtatggat
gccttcgactgccttcccctggctgcgctaatgaaccagcagttcctgtgtgtacacggt
ggtttgtctccagagattaacactctagatgacatcagaaaattagaccgattcaaagaa
ccacctgcttatgggcccatgtgtgacatcctatggtcagaccccctggaggactttgga
aatgagaagactcaggaacatttcactcacaacacagtcagaggctgttcgtacttctac
agttacccagctgtgtgtgacttcctgcagcacaataatttgttgtccatactccgcgcc
cacgaagcccaggatgcagggtaccgcatgtacaggaaaagccaaacaacaggcttcccg
tctctaattacaatcttctcggcaccaaattacttagatgtgtacaataacaaagctgca
gtgttgaagtacgagaacaatgtgatgaacatcaggcagttcaactgctccccgcatccg
tactggctcccaaatttcatggatgttttcacctggtcgctgccatttgttggggagaaa
gtgactgagatgctggtcaatgttctcaacatctgctccgacgatgaactggggtcagaa
gaagatggatttgacggagccacggccgcagcccggaaggaagtcatcagaaacaagatc
cgagcaataggcaaaatggccagagtgttctcagttctcagagaagagagtgagagtgtc
ctgacactgaagggcctgaccccaactggcatgctccccagcggagtgctctctggcggg
aaacagactctgcaaagcgctactgttgaggctattgaggctgatgaagccatcaaagga
ttttcaccacaacataagatcactagcttcgaggaggccaagggcttagaccgaattaac
gagaggatgccacctcgcagagacgccatgccctctgacgccaaccttaactccatcaac
aaggctctcgcctcagagactaacggcacggacagcaatggcagtaatagcagcaatatc
cagtga

KEGG   Mus musculus (mouse): 19056Help
Entry
19056             CDS       T01002                                 

Gene name
Ppp3cb, 1110063J16Rik, Calnb, CnAbeta, Cnab
Definition
(RefSeq) protein phosphatase 3, catalytic subunit, beta isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19056 (Ppp3cb)
   04310 Wnt signaling pathway
    19056 (Ppp3cb)
   04370 VEGF signaling pathway
    19056 (Ppp3cb)
   04020 Calcium signaling pathway
    19056 (Ppp3cb)
   04022 cGMP-PKG signaling pathway
    19056 (Ppp3cb)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19056 (Ppp3cb)
   04218 Cellular senescence
    19056 (Ppp3cb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19056 (Ppp3cb)
   04650 Natural killer cell mediated cytotoxicity
    19056 (Ppp3cb)
   04660 T cell receptor signaling pathway
    19056 (Ppp3cb)
   04658 Th1 and Th2 cell differentiation
    19056 (Ppp3cb)
   04659 Th17 cell differentiation
    19056 (Ppp3cb)
   04662 B cell receptor signaling pathway
    19056 (Ppp3cb)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19056 (Ppp3cb)
   04921 Oxytocin signaling pathway
    19056 (Ppp3cb)
   04924 Renin secretion
    19056 (Ppp3cb)
  09156 Nervous system
   04724 Glutamatergic synapse
    19056 (Ppp3cb)
   04728 Dopaminergic synapse
    19056 (Ppp3cb)
   04720 Long-term potentiation
    19056 (Ppp3cb)
  09158 Development and regeneration
   04360 Axon guidance
    19056 (Ppp3cb)
   04380 Osteoclast differentiation
    19056 (Ppp3cb)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19056 (Ppp3cb)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19056 (Ppp3cb)
   05014 Amyotrophic lateral sclerosis (ALS)
    19056 (Ppp3cb)
  09165 Substance dependence
   05031 Amphetamine addiction
    19056 (Ppp3cb)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19056 (Ppp3cb)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19056 (Ppp3cb)
   05170 Human immunodeficiency virus 1 infection
    19056 (Ppp3cb)
   05163 Human cytomegalovirus infection
    19056 (Ppp3cb)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19056 (Ppp3cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19056 (Ppp3cb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19056 (Ppp3cb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     19056 (Ppp3cb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 19056
NCBI-ProteinID: NP_032940
MGI: 107163
Ensembl: ENSMUSG00000021816
Vega: OTTMUSG00000034313
UniProt: P48453
LinkDB All DBs
Position
14; 14 A3
AA seq 525 aa AA seqDB search
MAAPEPARAAPPPPPPPPPPLGADRVVKAVPFPPTHRLTSEEVFDMDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDVGSAAARKEIIRNKIRAIGKMARVF
SVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSF
EEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTENHGTGNHSAQ
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccggagccggcccgggccgcgccgcccccgcccccgcccccaccgccccct
ctcggggccgaccgcgtcgtcaaagctgttccttttcccccaactcatcggctgacatct
gaagaagtgtttgatatggatgggatacccagggttgatgttctgaagaaccacttggta
aaagaagggcgggtggatgaagaaattgcactaagaattatcaatgagggtgctgccata
cttcggcgggagaaaaccatgatagaagtagaagctccaattacagtgtgtggtgacatc
catggccaattttttgatctgatgaaactttttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttattttagtatagagtgtgtctta
tatttatgggtcttgaagattctatacccaagcacattattccttctgagaggcaaccat
gaatgcagacaccttactgaatattttacctttaagcaggaatgtaaaattaaatattca
gaaagagtctatgaagcttgtatggaggcttttgacagcttgccccttgctgcacttcta
aaccaacaatttctttgtgttcatggtggactttcaccagaaatacacacactggatgat
attaggagattagatagatttaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtctgatccttctgaagactttggaaatgaaaaatcacaagaacattttagtcataat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggtttccttcattaataacaattttttcggcacctaattac
ttagatgtctacaataataaagctgctgtactaaagtatgaaaataatgtgatgaacatt
cgacagtttaattgctctccacatccttattggttgcccaattttatggatgtctttaca
tggtctttaccatttgttggagaaaaagtgacagaaatgttggtaaatgttctgagtatt
tgttctgatgatgaactaatgacagaaggtgaagaccagtttgatgtaggttcagctgca
gcccggaaagaaatcataagaaacaagatccgagcaattggcaagatggcaagagtcttc
tctgttctcagggaggagagtgaaagcgtgctgacactcaagggcctgactcccacaggg
atgttgcctagtggagtgttggctggaggacggcagaccttgcaaagtgccacagttgag
gctattgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagtttt
gaagaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagatgctgtg
cagcaagatggtttcaattccctgaacaccgcacataccactgagaaccacgggactggc
aaccatagtgcccagtga

KEGG   Mus musculus (mouse): 19057Help
Entry
19057             CDS       T01002                                 

Gene name
Ppp3cc, Calnc, PP2BA_gamma
Definition
(RefSeq) protein phosphatase 3, catalytic subunit, gamma isoform
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04728  Dopaminergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19057 (Ppp3cc)
   04310 Wnt signaling pathway
    19057 (Ppp3cc)
   04370 VEGF signaling pathway
    19057 (Ppp3cc)
   04020 Calcium signaling pathway
    19057 (Ppp3cc)
   04022 cGMP-PKG signaling pathway
    19057 (Ppp3cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19057 (Ppp3cc)
   04218 Cellular senescence
    19057 (Ppp3cc)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19057 (Ppp3cc)
   04650 Natural killer cell mediated cytotoxicity
    19057 (Ppp3cc)
   04660 T cell receptor signaling pathway
    19057 (Ppp3cc)
   04658 Th1 and Th2 cell differentiation
    19057 (Ppp3cc)
   04659 Th17 cell differentiation
    19057 (Ppp3cc)
   04662 B cell receptor signaling pathway
    19057 (Ppp3cc)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19057 (Ppp3cc)
   04921 Oxytocin signaling pathway
    19057 (Ppp3cc)
   04924 Renin secretion
    19057 (Ppp3cc)
  09156 Nervous system
   04724 Glutamatergic synapse
    19057 (Ppp3cc)
   04728 Dopaminergic synapse
    19057 (Ppp3cc)
   04720 Long-term potentiation
    19057 (Ppp3cc)
  09158 Development and regeneration
   04360 Axon guidance
    19057 (Ppp3cc)
   04380 Osteoclast differentiation
    19057 (Ppp3cc)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19057 (Ppp3cc)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19057 (Ppp3cc)
   05014 Amyotrophic lateral sclerosis (ALS)
    19057 (Ppp3cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    19057 (Ppp3cc)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19057 (Ppp3cc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19057 (Ppp3cc)
   05170 Human immunodeficiency virus 1 infection
    19057 (Ppp3cc)
   05163 Human cytomegalovirus infection
    19057 (Ppp3cc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19057 (Ppp3cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19057 (Ppp3cc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19057 (Ppp3cc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     19057 (Ppp3cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos DUF5378
Motif
Other DBs
NCBI-GeneID: 19057
NCBI-ProteinID: NP_032941
MGI: 107162
Ensembl: ENSMUSG00000022092
UniProt: P48455 Q80XK0
LinkDB All DBs
Position
14; 14 D2
AA seq 513 aa AA seqDB search
MSVRRPQFSTTERVIKAVPFPPTRRLTLKEVFENGKPKMDLLKNHLVKEGRVEEEVALKI
INDGAAILKQEKTMIEVEAPITVCGDVHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEMVYDACMHTFDC
LPLAALLNQQFLCVHGGMSPEITCLEDIRKLDRFSEPPAFGPVCDLLWSDPLEDYGSEKT
LEHYTHNTVRGCSYFFSYPAVCEFLQNNSLLSIIRAHEAQDAGYRMYRKNQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDEEMNVTDEEGATTGRKEVIKNKIRAIGKMARVFTVLREESENVLTLKGLT
PTGTLPLGVLSGGKQTIETAKQEAAEEREAIRGFTIAHRIRSFEEARGLDRINERMPPRK
EASYHHDAGRMHSHSHPPHPQASRRTDHGKKAL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaggcgccctcagttctccacgaccgagcgcgtcatcaaagctgtccccttt
cctccaacccgacggctaactttgaaggaagtttttgagaatgggaaacctaaaatggat
cttttgaaaaaccatttagtaaaagaaggtcgggtggaagaggaggtggccttaaagatc
atcaatgatggggctgccatcctgaagcaggagaagaccatgatagaggtggaggctccg
atcacagtgtgtggtgatgttcatggacaattctttgacctgatgaagttgtttgaagtt
gggggatcacctagtaatactcgctacctcttcctgggtgactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatctatggagcttaaagattaaccatcctaaaacattg
tttctgcttcgaggaaatcatgaatgcaggcatcttacagagtacttcaccttcaaacag
gaatgtcggatcaagtattcagagatggtgtacgatgcgtgcatgcacactttcgactgt
cttcctcttgctgccctcttaaaccagcagtttctctgtgtacatggaggaatgtctcct
gaaattacttgtttagaggacattaggaaattagataggttttctgagcctcctgctttt
gggccagtgtgtgacctgctgtggtctgatcccttagaggactacggcagcgagaagacc
ctggagcactatacccacaacactgtccgaggctgctcctacttcttcagttaccctgca
gtttgtgaatttttacagaacaacagtttattatcaataatcagagcccatgaagcccag
gatgcggggtaccgaatgtataggaagaaccaagcaactggctttccgtcacttattacg
attttctctgcccctaattacctagatgtctataacaataaagctgcagtgttgaagtat
gaaaacaatgtcatgaacatcaggcagttcaactgttccccacacccctactggctccca
aacttcatggatgttttcacgtggtctttgccttttgttggagagaaagtgacagagatg
ctggtcaatattctcaacatatgctcggatgaagaaatgaacgtaaccgatgaagaagga
gctactacaggtcgaaaagaagtcatcaagaataaaatccgagccattgggaaaatggcc
cgggtctttacggttcttcgggaagagagtgagaatgtgctgaccctcaagggcctcact
cccacaggcacactcccactgggggtcctctctggaggaaagcagaccattgagactgcc
aaacaagaagccgcagaggagcgggaagccatcagaggttttacaattgcacacaggatc
cgaagttttgaagaagcccgaggtctagaccgaattaatgagagaatgccaccccgaaaa
gaggcttcatatcatcatgatgcagggaggatgcactcacactcgcatccgccacaccca
caggcgtcaagaaggaccgaccatggaaagaaagccctgtaa

KEGG   Mus musculus (mouse): 19058Help
Entry
19058             CDS       T01002                                 

Gene name
Ppp3r1, CaNB1, Cnb1, MCIP1
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type I)
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19058 (Ppp3r1)
   04310 Wnt signaling pathway
    19058 (Ppp3r1)
   04370 VEGF signaling pathway
    19058 (Ppp3r1)
   04020 Calcium signaling pathway
    19058 (Ppp3r1)
   04022 cGMP-PKG signaling pathway
    19058 (Ppp3r1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19058 (Ppp3r1)
   04218 Cellular senescence
    19058 (Ppp3r1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19058 (Ppp3r1)
   04650 Natural killer cell mediated cytotoxicity
    19058 (Ppp3r1)
   04660 T cell receptor signaling pathway
    19058 (Ppp3r1)
   04658 Th1 and Th2 cell differentiation
    19058 (Ppp3r1)
   04659 Th17 cell differentiation
    19058 (Ppp3r1)
   04662 B cell receptor signaling pathway
    19058 (Ppp3r1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19058 (Ppp3r1)
   04921 Oxytocin signaling pathway
    19058 (Ppp3r1)
   04924 Renin secretion
    19058 (Ppp3r1)
  09156 Nervous system
   04724 Glutamatergic synapse
    19058 (Ppp3r1)
   04720 Long-term potentiation
    19058 (Ppp3r1)
  09158 Development and regeneration
   04360 Axon guidance
    19058 (Ppp3r1)
   04380 Osteoclast differentiation
    19058 (Ppp3r1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19058 (Ppp3r1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19058 (Ppp3r1)
   05014 Amyotrophic lateral sclerosis (ALS)
    19058 (Ppp3r1)
  09165 Substance dependence
   05031 Amphetamine addiction
    19058 (Ppp3r1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19058 (Ppp3r1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19058 (Ppp3r1)
   05170 Human immunodeficiency virus 1 infection
    19058 (Ppp3r1)
   05163 Human cytomegalovirus infection
    19058 (Ppp3r1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19058 (Ppp3r1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19058 (Ppp3r1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     19058 (Ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 19058
NCBI-ProteinID: NP_077779
MGI: 107172
Ensembl: ENSMUSG00000033953
Vega: OTTMUSG00000005195
UniProt: Q63810
LinkDB All DBs
Structure
PDB: 

Position
11; 11 A2
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcgagttaccctttggaaatgtgctcacactttgatgctgatgaaatt
aaaaggctaggaaagagattcaagaagcttgatttggacaattctggttctttgagcgtg
gaagagttcatgtctctgcctgagttacagcagaaccctttagtacagcgggtaatagat
atattcgacacagacggcaacggagaagtggacttcaaagaattcattgaaggagtgtct
cagttcagtgtcaaaggcgataaggaacagaagttgaggtttgcttttcgtatctatgac
atggataaagatggctatatttccaatggagaactcttccaggtgttgaagatgatggtg
ggcaacaatctgaaagatacacaattacagcagattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaggaattctgtgctgtcgtaggtggccta
gatatccacaaaaagatggtggtggatgtgtga

KEGG   Mus musculus (mouse): 19059Help
Entry
19059             CDS       T01002                                 

Gene name
Ppp3r2, CaNB2, CnB2
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type II)
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19059 (Ppp3r2)
   04310 Wnt signaling pathway
    19059 (Ppp3r2)
   04370 VEGF signaling pathway
    19059 (Ppp3r2)
   04020 Calcium signaling pathway
    19059 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    19059 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19059 (Ppp3r2)
   04218 Cellular senescence
    19059 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19059 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    19059 (Ppp3r2)
   04660 T cell receptor signaling pathway
    19059 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    19059 (Ppp3r2)
   04659 Th17 cell differentiation
    19059 (Ppp3r2)
   04662 B cell receptor signaling pathway
    19059 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19059 (Ppp3r2)
   04921 Oxytocin signaling pathway
    19059 (Ppp3r2)
   04924 Renin secretion
    19059 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    19059 (Ppp3r2)
   04720 Long-term potentiation
    19059 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    19059 (Ppp3r2)
   04380 Osteoclast differentiation
    19059 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19059 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19059 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis (ALS)
    19059 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    19059 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19059 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19059 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    19059 (Ppp3r2)
   05163 Human cytomegalovirus infection
    19059 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19059 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19059 (Ppp3r2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     19059 (Ppp3r2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 YtfJ_HI0045
Motif
Other DBs
NCBI-GeneID: 19059
NCBI-ProteinID: NP_001004025
MGI: 107171
Ensembl: ENSMUSG00000028310
Vega: OTTMUSG00000006951
UniProt: Q63811 Q497S1
LinkDB All DBs
Position
4; 4 B1
AA seq 179 aa AA seqDB search
MGNEASYQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVID
IFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIHKKLVVFVEHGQEDLKA
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggccagctaccaaactgagctgtgcaaccacttcgaccaggaagagata
agaaggctgggtaaaagcttcaggaagctggacttggacaaatcgggctccctgagcata
gaagagttcatgaggctgcctgagctgcagcagaatccgctggtgggccgagtgatcgac
atcttcgacacagacggcaacggggaagtggacttccacgagttcatcgtgggcacctcc
cagttcagcgtcaagggtgatgaagagcagaagctaaggttcgccttcagaatctacgac
atggataatgatggcttcatctccaatggggagctcttccaggtgcttaagatgatggtg
ggaaacaacctcaaggactggcagctgcagcagctggtggacaagagcatcttggtcctg
gataaggatggcgatggccggatatcctttgaagagttcagtgatgtggtcaagaccatg
gagatccacaagaaattggtcgtgtttgtagaacacggtcaagaagacttaaaagcttaa

DBGET integrated database retrieval system