KEGG   Mus musculus (mouse): 19206Help
Entry
19206             CDS       T01002                                 

Gene name
Ptch1, A230106A15Rik, Ptc, Ptc1, Ptch, mes, wig
Definition
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04340  Hedgehog signaling pathway
mmu04360  Axon guidance
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    19206 (Ptch1)
   04024 cAMP signaling pathway
    19206 (Ptch1)
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    19206 (Ptch1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19206 (Ptch1)
   05205 Proteoglycans in cancer
    19206 (Ptch1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    19206 (Ptch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patched Sterol-sensing
Motif
Other DBs
NCBI-GeneID: 19206
NCBI-ProteinID: NP_032983
MGI: 105373
Ensembl: ENSMUSG00000021466
Vega: OTTMUSG00000050865
UniProt: Q61115 Q3TQB0 Q5R252 Q3UUD4
LinkDB All DBs
Structure
PDB: 

Position
13 B3; 13 32.8 cM
AA seq 1434 aa AA seqDB search
MASAGNAAGALGRQAGGGRRRRTGGPHRAAPDRDYLHRPSYCDAAFALEQISKGKATGRK
APLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGG
RVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYN
RQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLLGKPPL
RWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPADPDCPATAPNKNST
KPLDVALVLNGGCQGLSRKYMHWQEELIVGGTVKNATGKLVSAHALQTMFQLMTPKQMYE
HFRGYDYVSHINWNEDRAAAILEAWQRTYVEVVHQSVAPNSTQKVLPFTTTTLDDILKSF
SDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSVAAGLGLCSLIGIS
FNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECLKRTGASVALTSIS
NVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLYRREDRRLDIFCCF
TSPCVSRVIQVEPQAYTEPHSNTRYSPPPPYTSHSFAHETHITMQSTVQLRTEYDPHTHV
YYTTAEPRSEISVQPVTVTQDNLSCQSPESTSSTRDLLSQFSDSSLHCLEPPCTKWTLSS
FAEKHYAPFLLKPKAKVVVILLFLGLLGVSLYGTTRVRDGLDLTDIVPRETREYDFIAAQ
FKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLPQMWLHYFRDWLQG
LQDAFDSDWETGRIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGII
NPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRLRIPAAEPIEYAQF
PFYLNGLRDTSDFVEAIEKVRVICNNYTSLGLSSYPNGYPFLFWEQYISLRHWLLLSISV
VLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSAVPVVILIASVGIGV
EFTVHVALAFLTAIGDKNHRAMLALEHMFAPVLDGAVSTLLGVLMLAGSEFDFIVRYFFA
VLAILTVLGVLNGLVLLPVLLSFFGPCPEVSPANGLNRLPTPSPEPPPSVVRFAVPPGHT
NNGSDSSDSEYSSQTTVSGISEELRQYEAQQGAGGPAHQVIVEATENPVFARSTVVHPDS
RHQPPLTPRQQPHLDSGSLSPGRQGQQPRRDPPREGLRPPPYRPRRDAFEISTEGHSGPS
NRDRSGPRGARSHNPRNPTSTAMGSSVPSYCQPITTVTASASVTVAVHPPPGPGRNPRGG
PCPGYESYPETDHGVFEDPHVPFHVRCERRDSKVEVIELQDVECEERPWGSSSN
NT seq 4305 nt NT seq  +upstreamnt  +downstreamnt
atggcctcggctggtaacgccgccggggccctgggcaggcaggccggcggcgggaggcgc
agacggaccgggggaccgcaccgcgccgcgccggaccgggactatctgcaccggcccagc
tactgcgacgccgccttcgctctggagcagatttccaaggggaaggctactggccggaaa
gcgccgctgtggctgagagcgaagtttcagagactcttatttaaactgggttgttacatt
caaaagaactgcggcaagtttttggttgtgggtctcctcatatttggggccttcgctgtg
ggattaaaggcagctaatctcgagaccaacgtggaggagctgtgggtggaagttggtgga
cgagtgagtcgagaattaaattatacccgtcagaagataggagaagaggctatgtttaat
cctcaactcatgatacagactccaaaagaagaaggcgctaatgttctgaccacagaggct
ctcctgcaacacctggactcagcactccaggccagtcgtgtgcacgtctacatgtataac
aggcaatggaagttggaacatttgtgctacaaatcaggggaacttatcacggagacaggt
tacatggatcagataatagaatacctttacccttgcttaatcattacacctttggactgc
ttctgggaaggggcaaagctacagtccgggacagcatacctcctaggtaagcctccttta
cggtggacaaactttgaccccttggaattcctagaagagttaaagaaaataaactaccaa
gtggacagctgggaggaaatgctgaataaagccgaagttggccatgggtacatggaccgg
ccttgcctcaacccagccgacccagattgccctgccacagcccctaacaaaaattcaacc
aaacctcttgatgtggcccttgttttgaatggtggatgtcaaggtttatccaggaagtat
atgcattggcaggaggagttgattgtgggtggtaccgtcaagaatgccactggaaaactt
gtcagcgctcacgccctgcaaaccatgttccagttaatgactcccaagcaaatgtatgaa
cacttcaggggctacgactatgtctctcacatcaactggaatgaagacagggcagccgcc
atcctggaggcctggcagaggacttacgtggaggtggttcatcaaagtgtcgccccaaac
tccactcaaaaggtgcttcccttcacaaccacgaccctggacgacatcctaaaatccttc
tctgatgtcagtgtcatccgagtggccagcggctacctactgatgcttgcctatgcctgt
ttaaccatgctgcgctgggactgctccaagtcccagggtgccgtggggctggctggcgtc
ctgttggttgcgctgtcagtggctgcaggattgggcctctgctccttgattggcatttct
tttaatgctgcgacaactcaggttttgccgtttcttgctcttggtgttggtgtggatgat
gtcttcctcctggcccatgcattcagtgaaacaggacagaataagaggattccatttgag
gacaggactggggagtgcctcaagcgcaccggagccagcgtggccctcacctccatcagc
aatgtcaccgccttcttcatggccgcattgatccctatccctgccctgcgagcgttctcc
ctccaggctgctgtggtggtggtattcaattttgctatggttctgctcatttttcctgca
attctcagcatggatttatacagacgtgaggacagaagattggatattttctgctgtttc
acaagcccctgtgtcagcagggtgattcaagttgagccacaggcctacacagagcctcac
agtaacacccggtacagccccccacccccatacaccagccacagcttcgcccacgaaacc
catatcactatgcagtccaccgttcagctccgcacagagtatgaccctcacacgcacgtg
tactacaccaccgccgagccacgctctgagatctctgtacagcctgttaccgtcacccag
gacaacctcagctgtcagagtcccgagagcaccagctctaccagggacctgctctcccag
ttctcagactccagcctccactgcctcgagcccccctgcaccaagtggacactctcttcg
tttgcagagaagcactatgctcctttcctcctgaaacccaaagccaaggttgtggtaatc
cttcttttcctgggcttgctgggggtcagcctttatgggaccacccgagtgagagacggg
ctggacctcacggacattgttccccgggaaaccagagaatatgacttcatagctgcccag
ttcaagtacttctctttctacaacatgtatatagtcacccagaaagcagactacccgaat
atccagcacctactttacgaccttcataagagtttcagcaatgtgaagtatgtcatgctg
gaggagaacaagcaacttccccaaatgtggctgcactactttagagactggcttcaagga
cttcaggatgcatttgacagtgactgggaaactgggaggatcatgccaaacaattataaa
aatggatcagatgacggggtcctcgcttacaaactcctggtgcagactggcagccgagac
aagcccatcgacattagtcagttgactaaacagcgtctggtagacgcagatggcatcatt
aatccgagcgctttctacatctacctgaccgcttgggtcagcaacgaccctgtagcttac
gctgcctcccaggccaacatccggcctcaccggccggagtgggtccatgacaaagccgac
tacatgccagagaccaggctgagaatcccagcagcagagcccatcgagtacgctcagttc
cctttctacctcaacggcctacgagacacctcagactttgtggaagccatagaaaaagtg
agagtcatctgtaacaactatacgagcctgggactgtccagctaccccaatggctacccc
ttcctgttctgggagcaatacatcagcctgcgccactggctgctgctatccatcagcgtg
gtgctggcctgcacgtttctagtgtgcgcagtcttcctcctgaacccctggacggccggg
atcattgtcatggtcctggctctgatgaccgttgagctctttggcatgatgggcctcatt
gggatcaagctgagtgctgtgcctgtggtcatcctgattgcatctgttggcatcggagtg
gagttcaccgtccacgtggctttggcctttctgacagccattggggacaagaaccacagg
gctatgctcgctctggagcacatgtttgctcccgttctggacggtgctgtgtccactctg
ctgggtgtactgatgcttgcagggtccgaatttgatttcattgtcagatacttctttgcc
gtcctggccattctcaccgtcttgggggttctcaatggactggttctgctgcctgtcctc
ttatccttctttggaccgtgtcctgaggtgtctccagccaatggcctaaaccgactgccc
actccttcgcctgagccgcctccaagtgtcgtccggtttgccgtgcctcctggtcacacg
aacaatgggtctgattcctccgactcggagtacagctctcagaccacggtgtctggcatc
agtgaggagctcaggcaatacgaagcacagcagggtgccggaggccctgcccaccaagtg
attgtggaagccacagaaaaccctgtctttgcccggtccactgtggtccatccggactcc
agacatcagcctcccttgacccctcggcaacagccccacctggactctggctccttgtcc
cctggacggcaaggccagcagcctcgaagggatccccctagagaaggcttgcggccaccc
ccctacagaccgcgcagagacgcttttgaaatttctactgaagggcattctggccctagc
aatagggaccgctcagggccccgtggggcccgttctcacaaccctcggaacccaacgtcc
accgccatgggcagctctgtgcccagctactgccagcccatcaccactgtgacggcttct
gcttcggtgactgttgctgtgcatcccccgcctggacctgggcgcaacccccgagggggg
ccctgtccaggctatgagagctaccctgagactgatcacggggtatttgaggatcctcat
gtgccttttcatgtcaggtgtgagaggagggactcaaaggtggaggtcatagagctacag
gacgtggaatgtgaggagaggccgtgggggagcagctccaactga

KEGG   Mus musculus (mouse): 19207Help
Entry
19207             CDS       T01002                                 

Gene name
Ptch2, ptc2
Definition
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    19207 (Ptch2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19207 (Ptch2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    19207 (Ptch2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patched Sterol-sensing MMPL
Motif
Other DBs
NCBI-GeneID: 19207
NCBI-ProteinID: NP_032984
MGI: 1095405
Ensembl: ENSMUSG00000028681
Vega: OTTMUSG00000009923
UniProt: O35595
LinkDB All DBs
Position
4 D1; 4 53.41 cM
AA seq 1182 aa AA seqDB search
MVRPLSLGELPPSYTPPARSSAPHILAGSLQAPLWLRAYFQGLLFSLGCRIQKHCGKVLF
LGLVAFGALALGLRVAVIETDLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAH
QEGGNVLTPEALDLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPQQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLDPDDPHCPPSAPNRHSRQAPNVAQELSGGCHGFSHKFMHWQEELLLG
GTARDLQGQLLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASMVLQAWQRRFV
QLAQEALPANASQQIHAFSSTTLDDILRAFSEVSTTRVVGGYLLMLAYACVTMLRWDCAQ
SQGAVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDIFLLAHAFTK
APPDTPLPERMGECLRSTGTSVALTSVNNMVAFFMAALVPIPALRAFSLQAAIVVGCNFA
AVMLVFPAILSLDLRRRHRQRLDVLCCFSSPCSAQVIQMLPQELGDRAVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLLSPASDPLGSELYSPGGSTRDLLSQEEGTGPQAACRP
LLCAHWTLAHFARYQFAPLLLQTRAKALVLLFFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRSWLQGIQAAFDQDWASGRITCHSYRNGSEDGALAYKLLIQTGNAQEPLDFSQLT
TRKLVDKEGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
AAQPLEFAQFPFLLHGLQKTADFVEAIEGARAACTEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLSPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASIGIGVEFTVHVALGFLTSHGSRNLRAASALEQTFAPVTDGAVSTLLGLLMLAGSN
FDFIIRYFFVVLTVLTLLGLLHGLLLLPVLLSILGPPPQVVQVYKESPQTLNSAAPQRGG
LRWDRPPTLPQSFARVTTSMTVALHPPPLPGAYVHPASEEPT
NT seq 3549 nt NT seq  +upstreamnt  +downstreamnt
atggttcggccactgtcccttggagagctacctcccagctacacacctccagctcggtcc
tccgcacctcatatcctagctgggagcctgcaggctcctctctggcttcgagcttacttc
caaggtctactcttctccctggggtgcaggatccagaaacactgcggcaaagtgctcttc
ctgggactggtggcctttggggctctggcactgggtctccgagtggctgtaattgagaca
gacctagaacagctctgggtagaagtgggcagcagggtgagccaggagctgcactacacc
aaggagaagctgggggaagaggctgcgtacacctcccagatgttgattcagactgcgcac
caggaagggggaaacgtcctcacccccgaggcacttgacttgcacctccaggcggcgctc
actgccagtaaagtccaagtatcactctatgggaaatcctgggatttgaacaagatctgc
tacaaatcaggggttccccttattgaaaatgggatgatcgagcggatgattgagaagctg
tttccctgtgtgatcctcaccccgcttgactgcttctgggaaggagccaaactccaaggg
ggctctgcctacttgccgggccgccctgatatccagtggaccaacctggaccctcagcag
ctgctcgaggagctgggcccctttgcctctctggagggcttccgggaactgctagataag
gcacaggtgggccaggcctatgtggggcgaccctgtctggaccctgatgacccccactgt
ccacctagtgctcccaaccggcacagcaggcaggctcccaatgtggctcaggagctgagt
gggggctgccatggcttctcccacaagttcatgcactggcaggaggaactgctactaggg
ggcacagccagagatctccaaggacagctgctgagggcagaggccttgcagagcaccttc
ctgctcatgagtccccgtcagctgtacgagcacttccggggcgactaccagacacatgac
atcggctggagcgaggagcaggccagcatggtgctgcaggcctggcagaggcgctttgtg
cagctagcccaggaggctctgccggccaacgcgtcccagcagatccatgccttctcctcc
accaccctggatgacatcctgcgcgcgttctctgaagtcagcaccacccgtgtggtagga
ggctatctgcttatgctggcctatgcctgcgtaacaatgctgcggtgggactgcgcccag
tcccagggtgccgtaggtcttgctggggtgttgctggtggccctggcggtggcctcaggt
cttgggctttgtgccctacttggcatcactttcaatgctgccactacacaggtgctgccc
ttcttggctctgggcattggcgtggatgacatcttcctgctggcgcatgccttcacaaaa
gccccacctgacacccctctcccagagcgtatgggtgagtgtttgaggagcacgggcacc
agcgtggcactcacatccgtcaacaacatggtcgcctttttcatggctgccctggttccc
attcctgcgctgcgggccttctccctgcaggcagccatagtggtcggctgcaactttgca
gcggtaatgctcgtcttccctgccatcctcagcctcgacctgcgccggcgccaccgccaa
cgcctggacgttctctgctgcttttctagcccctgctccgctcaggtcattcagatgctg
ccccaggagctaggggacagagcagtaccagtgggcattgcccacctgactgccaccgtg
caagccttcacccactgcgaagccagcagccagcatgtagtcaccattttgcctcctcaa
gcccacctgctgtctccagcttctgacccactgggctccgaactctatagccctggaggg
tctacacgggaccttctcagtcaggaggaggggacagggccacaggcggcctgcaggccc
ctgctctgtgcccactggactctcgcccattttgcccgctatcagtttgcacctttactg
ctccagacacgagccaaggccctggtgttgctgttctttggggctcttttgggcctgagc
ctctatggagccaccttggtacaagatgggctggccctgacagatgtggtccctaggggc
accaaggaacatgctttcctgagcgcccagctcaggtacttctccctgtacgaggtggct
ctagtgacacagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagctccctcaaggctgtgctgcccccacctgccacccaggcaccccgcacc
tggcttcactactaccgcagctggctacagggtatccaggctgcatttgaccaagactgg
gcttctgggcgcatcacctgccactcttaccgcaacggctcagaagatggcgccctggcc
tacaagctgctcatccaaaccgggaatgcccaggagcctctggatttcagccagctgacc
acaaggaaactggtggacaaggagggactcattcccccagagctcttctacatggggcta
accgtgtgggtgagcagcgaccccctgggcctcgcagcctctcaggccaacttctacccc
ccacctccagagtggcttcacgacaaatatgataccaccggggagaaccttcgcatcccg
gcagcccagcccttggagtttgcccagttccccttcctgctgcatggactccagaagact
gcagactttgtagaagccatcgaaggggccagggcggcatgcacagaggcaggccaggca
ggggtgcatgcctaccccagtggctcccccttcctcttctgggagcagtatctgggtctt
cggcgctgcttcctgctggcagtctgcatcttgctggtgtgcaccttcctcgtctgtgcc
ctgcttctactcagcccgtggacagctggcctcatagtgctggtcctggcaatgatgact
gtggagctctttggtatcatgggattcctgggcatcaaactgagtgccatccccgtggta
atcctcgtggcctctataggcattggtgttgaattcacagttcacgtggctctgggcttc
ctgaccagccatggtagccggaacctgcgggctgctagcgctctggaacagacctttgcc
cctgtgactgatggagctgtctccaccttgctgggtctgctcatgcttgctggttctaac
tttgacttcatcataaggtatttctttgtggtgctgacggtgctgacactcttgggcctg
ctccatggactcctgctgctgcctgtgctgctctctatcctaggccccccgccacaggtg
gtgcaggtatacaaggagagtccacagaccctaaactccgctgctccacagagaggtggg
ctcaggtgggacaggccccccaccctgccccagagttttgccagagtgactacctccatg
actgtggccctccacccaccacctctgcctggagcatacgtccacccagcctccgaggag
cccacatag

DBGET integrated database retrieval system