KEGG   Mus musculus (mouse): 19216Help
Entry
19216             CDS       T01002                                 

Gene name
Ptger1, EP1, Ptgerep1
Definition
(RefSeq) prostaglandin E receptor 1 (subtype EP1)
  KO
K04258  prostaglandin E receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    19216 (Ptger1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19216 (Ptger1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19216 (Ptger1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19216 (Ptger1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19216 (Ptger1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19216 (Ptger1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 19216
NCBI-ProteinID: NP_038669
MGI: 97793
Ensembl: ENSMUSG00000019464
Vega: OTTMUSG00000025957
UniProt: P35375 B2RS62
LinkDB All DBs
Position
8 C2; 8 40.22 cM
AA seq 405 aa AA seqDB search
MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVLAAMALAVALLPLVHVGR
YELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRHSGFSHL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctgcgggcttaacctgagcctagcggatgaggcagcaacgtgcgcaacaccc
aggctccccaatacatctgtggtgctgccaacaggcgataatggcacatcaccagcgctg
cctatcttctccatgacgctgggtgctgtgtccaacgtgctggcgctggcgctgctggcc
caggttgcaggccgaatgcggcggcgccgctcggctgccaccttcctgttgttcgtcgcc
agcctgcttgccatcgacctagcaggccatgtgatcccgggcgccctggtgcttcgcctg
tatactgcggggcgtgcgcctgctggaggggcgtgtcatttcctgggtggctgcatggtc
ttcttcggcctgtgcccacttttgcttggctgtggcatggccgtagagcgctgtgtgggt
gtcacgcagccactgatccacgcggcgcgcgtatctgtggcccgcgcacgcctggcacta
gccgtgctggctgccatggctttggcagtggcgctgctgccactggtacacgtgggtcgc
tacgagttacagtaccctggcacctggtgttttattagccttgggcctcgtggaggttgg
cgccaggcgttgcttgccggcctcttcgccggccttggcctggccgcgctccttgcggca
ttagtgtgcaatacgctcagcggcctggcgctcctccgtgcccgctggagacggcgtcgc
tctcgacgattccgaaagaccgcaggtcccgatgatcgccggcgctggggatctcgtgga
ccccgcttggcctccgcctcgtctgcctcatccatcacttcagccacagccaccctccgc
agctctcggggcggcggctccgcgcgcagggttcacgcacacgatgtggaaatggtgggc
cagctcgtgggcatcatggtggtgtcgtgcatctgctggagccccctgctggtgttggtg
gtgttggccatcgggggctggaactctaactccctgcagcggccactctttctggctgta
cgcctcgcatcgtggaaccagatcctggacccatgggtgtacatcctgctgcgccaggcc
atgctgcgccaactgcttcgcctcctacccctgagggtcagtgccaagggtggtccaacg
gagctgggcctaaccaagagtgcctgggaagccagttcactgcgtagttcccggcacagt
ggtttcagtcacctctga

KEGG   Mus musculus (mouse): 19217Help
Entry
19217             CDS       T01002                                 

Gene name
Ptger2, EP2, Ptgerep2
Definition
(RefSeq) prostaglandin E receptor 2 (subtype EP2)
  KO
K04259  prostaglandin E receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04924  Renin secretion
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    19217 (Ptger2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19217 (Ptger2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    19217 (Ptger2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19217 (Ptger2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19217 (Ptger2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19217 (Ptger2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19217 (Ptger2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19217 (Ptger2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srb SUR7
Motif
Other DBs
NCBI-GeneID: 19217
NCBI-ProteinID: NP_032990
MGI: 97794
Ensembl: ENSMUSG00000037759
Vega: OTTMUSG00000036411
UniProt: Q62053 Q543A9
LinkDB All DBs
Position
14 C1; 14 22.68 cM
AA seq 362 aa AA seqDB search
MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG
SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF
SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV
QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS
SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA
LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG
QL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacaattttcttaatgactccaagctaatggaggactgcaagagtcgtcagtggctc
ctttcgggggaaagcccagccatcagctcggtgatgttctcggccggggttctggggaat
ctcatcgcactggcactgttggcgcgccgctggcgtggggacaccgggtgtagcgccggc
agcaggacctctatctccttgtttcacgtgctggtaacggaattggtgctcactgacctg
ctgggaacctgcctcatcagcccggtggtgctggcttcatattcaagaaaccagaccctg
gtggccctggctcccgaaagtcacgcgtgtacctatttcgctttcactatgaccttcttt
agtctggccacgatgctcatgctcttcgctatggccctggaacgctacctctccatcggg
tacccttacttctacaggcgccacttatcgcgccgcgggggtctggcggtgctgcctgtc
atctatggggcctccttgctcttctgttccctgccgctgctcaactacggggagtacgtc
cagtactgtcctgggacatggtgctttatccggcacgggaggactgcataccttcagctg
tacgccacgatgctcctgctgcttatcgtggctgtgctcgcctgcaacatcagcgttatc
ctcaacctcattcgcatgcaccgtcggagcagaagaagccgctgcggattgtctggcagt
agcctaagaggccctggatctcgcaggagaggagagaggacttcgatggcagaggagacg
gaccacctcattctcctggccattatgaccatcaccttcgccatatgctccttgcctttc
acaatctttgcctacatggatgaaacctcttccctaaaggaaaagtgggacctccgagct
cttcggtttttatcagttaactctataattgacccttgggtctttgccatacttaggcca
ccggtcctgaggttaatgcgctcagtcctctgttgtcggacttcactgagaacacaagaa
gctcagcaaacatcctgttctacccagtccagtgccagtaaacagactgacctttgtgga
cagttgtga

KEGG   Mus musculus (mouse): 19218Help
Entry
19218             CDS       T01002                                 

Gene name
Ptger3, EP3, Pgerep3, Ptgerep3
Definition
(RefSeq) prostaglandin E receptor 3 (subtype EP3)
  KO
K04260  prostaglandin E receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04923  Regulation of lipolysis in adipocytes
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    19218 (Ptger3)
   04024 cAMP signaling pathway
    19218 (Ptger3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19218 (Ptger3)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    19218 (Ptger3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19218 (Ptger3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19218 (Ptger3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19218 (Ptger3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19218 (Ptger3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srbc DUF2207
Motif
Other DBs
NCBI-GeneID: 19218
NCBI-ProteinID: NP_001346674
MGI: 97795
Ensembl: ENSMUSG00000040016
Vega: OTTMUSG00000037109
LinkDB All DBs
Position
3 H4; 3 81.32 cM
AA seq 366 aa AA seqDB search
MASMWAPEHSAEAHSNLSSTTDDCGSVSVAFPITMMVTGFVGNALAMLLVSRSYRRRESK
RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS
SLLVASAMAVERALAIRAPHWYASHMKTRATRAVLLGVWLSVLAFALLPVLGVGRYSVQW
PGTWCFISTGPAGNETDPAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAK
AAVSQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEK
ECNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSALMW
SDQLER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctagcatgtgggcgccggagcactctgctgaagcgcacagcaacctgtcaagtact
accgacgactgcggctccgtgtccgtggcctttcccatcaccatgatggtcactggcttc
gtgggcaacgcgctggccatgctgctcgtgtcgcgcagctaccggcgccgcgagagcaag
cgcaagaagtctttcctgctgtgcattggctggctggcgctcaccgacttagtggggcag
ctcctgaccagcccggtggtcatcctcgtgtacctgtcacagcgacgctgggagcagctc
gacccatcggggcgtctgtgcaccttcttcgggctaaccatgacagtgttcgggctatcc
tcgctcctggtggccagcgccatggccgtggagcgcgccctggccatccgtgcgccgcac
tggtatgccagccacatgaagactcgcgccacgcgcgcggtactgctgggcgtgtggctg
tctgtgctcgccttcgcgctgctgccggtgctgggcgtgggccgctacagcgtgcagtgg
ccgggcacgtggtgcttcatcagcaccgggccggcgggcaacgagacagaccctgcgcgc
gagccgggcagcgtggcctttgcctccgccttcgcctgcttgggcttgctggctctggtg
gtgacctttgcctgcaacctggcgaccatcaaagccctggtgtcccgctgtcgggccaaa
gccgccgtctcgcagtccagcgcccagtggggcagaatcaccacggagacggccatccag
ctcatggggatcatgtgtgtgctgtccgtctgttggtcgccgctattgataatgatgttg
aaaatgatcttcaatcagatgtcggttgagcaatgcaagacacagatgggaaaggagaag
gagtgcaattcctttctaattgcagttcgcctggcttcgctgaaccagatcttggatccc
tgggtttatctgctgctaagaaagatccttcttcggaagttctgccagatcagagaccac
accaactatgcttccagctccacctccttgccctgcccaggctcctcagccctgatgtgg
agtgaccagctggaaagatga

KEGG   Mus musculus (mouse): 19219Help
Entry
19219             CDS       T01002                                 

Gene name
Ptger4, EP4, Ptgerep4
Definition
(RefSeq) prostaglandin E receptor 4 (subtype EP4)
  KO
K04261  prostaglandin E receptor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04924  Renin secretion
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19219 (Ptger4)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    19219 (Ptger4)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19219 (Ptger4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19219 (Ptger4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19219 (Ptger4)
   05165 Human papillomavirus infection
    19219 (Ptger4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19219 (Ptger4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19219 (Ptger4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx NdhL Abhydrolase_9_N
Motif
Other DBs
NCBI-GeneID: 19219
NCBI-ProteinID: NP_032991
MGI: 104311
Ensembl: ENSMUSG00000039942
Vega: OTTMUSG00000027987
UniProt: P32240
LinkDB All DBs
Position
15 A1; 15 1.99 cM
AA seq 513 aa AA seqDB search
MAEVGGTIPRSNRELQRCVLLTTTIMSIPGVNASFSSTPERLNSPVTIPAVMFIFGVVGN
LVAIVVLCKSRKEQKETTFYTLVCGLAVTDLLGTLLVSPVTIATYMKGQWPGDQALCDYS
TFILLFFGLSGLSIICAMSIERYLAINHAYFYSHYVDKRLAGLTLFAIYASNVLFCALPN
MGLGRSERQYPGTWCFIDWTTNVTAYAAFSYMYAGFSSFLILATVLCNVLVCGALLRMHR
QFMRRTSLGTEQHHAAAAAAVASVACRGHAGASPALQRLSDFRRRRSFRRIAGAEIQMVI
LLIATSLVVLICSIPLVVRVFINQLYQPNVVKDISRNPDLQAIRIASVNPILDPWIYILL
RKTVLSKAIEKIKCLFCRIGGSGRDSSAQHCSESRRTSSAMSGHSRSFLARELKEISSTS
QTLLYLPDLTESSLGGRNLLPGSHGMGLTQADTTSLRTLRISETSDSSQGQDSESVLLVD
EVSGSHREEPASKGNSLQVTFPSETLKLSEKCI
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggttggaggtaccattcctagatcgaaccgtgagctccaacgctgtgtgtta
ctaaccaccaccatcatgtccatccccggagtcaacgcgtccttctcctccactccggag
aggctgaacagcccggtgaccattcccgcagtgatgttcatcttcggggtggtgggcaac
ctggtggccatcgtagtattgtgcaagtcgcgcaaggagcagaaagagacgaccttttac
actctagtatgtgggctggctgtcactgaccttctgggcaccttgttggtaagcccggtg
accatcgccacatacatgaagggccagtggcccggagaccaggcactgtgtgactatagc
accttcatcctacttttcttcggtctgtcgggtctcagcatcatctgtgccatgagcatc
gagcgctacctggccatcaaccacgcctacttctacagccactacgtggacaagcggctg
gccggcctcacactcttcgccatctatgcatctaacgtgctgttctgcgcgctgcccaac
atgggcctgggcagatccgagcggcagtacccgggcacctggtgcttcatcgactggacc
accaacgtaacggcctacgccgccttctcttacatgtacgccggcttcagctccttcctc
atccttgccaccgtgctctgcaacgtgctggtgtgcggcgcgctgctccgcatgcaccgc
cagttcatgcgccgcacctcgttgggcacggagcagcaccatgcggctgccgccgccgcg
gtagcttcggtggcctgtcggggccacgctggggcctccccagccctgcagcgcctcagc
gactttcgccgccgcaggagtttccggcgcatcgcgggtgcggagatccagatggtcatc
ttactcatcgccacctctctggtggtgctcatctgctccattccgctcgtggtgcgagtg
ttcattaaccagttatatcagccaaacgtggtgaaagacatcagcagaaacccagatttg
caggccatcaggattgcttctgtgaaccccatcctggacccctggatttacatccttctt
cggaagactgtgctcagtaaagccatagagaagatcaagtgcctcttctgccgcattggc
ggttccggcagagacagctcggcccagcactgctcagagagtcggaggacatcttccgcc
atgtccggccactctcgctccttcctcgcccgggagttaaaggagatcagcagcacgtcc
cagaccctcctgtacctgccagacctgactgaaagcagcctcggaggcaggaatttgctt
ccaggttcgcatggcatgggcctgacccaagcagacaccacctcgctgagaactttgcga
atttccgagacctcagactcctcccagggccaggactctgagagtgtcctgttggtggat
gaggttagtgggagccacagagaggagcctgcctctaaaggaaactctctgcaagtcaca
ttccccagtgaaactctgaaattatctgaaaaatgtatatag

DBGET integrated database retrieval system