KEGG   Mus musculus (mouse): 19225Help
Entry
19225             CDS       T01002                                 

Gene name
Ptgs2, COX2, Cox-2, PES-2, PGHS-2, PHS_II, PHS-2, Pghs2, TIS10, gripghs
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00590  Arachidonic acid metabolism
mmu01100  Metabolic pathways
mmu04064  NF-kappa B signaling pathway
mmu04370  VEGF signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04726  Serotonergic synapse
mmu04913  Ovarian steroidogenesis
mmu04921  Oxytocin signaling pathway
mmu04923  Regulation of lipolysis in adipocytes
mmu05140  Leishmaniasis
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05200  Pathways in cancer
mmu05204  Chemical carcinogenesis
mmu05206  MicroRNAs in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    19225 (Ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    19225 (Ptgs2)
   04064 NF-kappa B signaling pathway
    19225 (Ptgs2)
   04668 TNF signaling pathway
    19225 (Ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19225 (Ptgs2)
   04657 IL-17 signaling pathway
    19225 (Ptgs2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    19225 (Ptgs2)
   04913 Ovarian Steroidogenesis
    19225 (Ptgs2)
   04921 Oxytocin signaling pathway
    19225 (Ptgs2)
  09156 Nervous system
   04726 Serotonergic synapse
    19225 (Ptgs2)
   04723 Retrograde endocannabinoid signaling
    19225 (Ptgs2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    19225 (Ptgs2)
   05206 MicroRNAs in cancer
    19225 (Ptgs2)
   05204 Chemical carcinogenesis
    19225 (Ptgs2)
   05222 Small cell lung cancer
    19225 (Ptgs2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    19225 (Ptgs2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19225 (Ptgs2)
   05165 Human papillomavirus infection
    19225 (Ptgs2)
   05140 Leishmaniasis
    19225 (Ptgs2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     19225 (Ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 19225
NCBI-ProteinID: NP_035328
MGI: 97798
Ensembl: ENSMUSG00000032487
Vega: OTTMUSG00000049547
UniProt: Q05769
LinkDB All DBs
Structure
PDB: 

Position
1 G1; 1 63.84 cM
AA seq 604 aa AA seqDB search
MLFRAVLLCAALGLSQAANPCCSNPCQNRGECMSTGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIVNNIPFLRSLIMKYVLTSRSYLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGNKELPDSKEVLEKVLLRREFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPGFTRGLGHGVDLNHIYGETLDRQHKLRLFKDGKLKY
QVIGGEVYPPTVKDTQVEMIYPPHIPENLQFAVGQEVFGLVPGLMMYATIWLREHNRVCD
ILKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIASEFNTLYHWHPLLPDTFNIEDQEYSFKQFLYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVPIAVQAVAKASIDQSREMKYQSLNEYRKRFSLKPYTSFEELTGEKEMAAELKAL
YSDIDVMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQDPQPTKTATINASASHSRLDDINPTVLIKRR
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcttccgagctgtgctgctctgcgctgccctggggctcagccaggcagcaaatcct
tgctgttccaatccatgtcaaaaccgtggggaatgtatgagcacaggatttgaccagtat
aagtgtgactgtacccggactggattctatggtgaaaactgtactacacctgaatttctg
acaagaatcaaattactgctgaagcccaccccaaacacagtgcactacatcctgacccac
ttcaagggagtctggaacattgtgaacaacatccccttcctgcgaagtttaatcatgaaa
tatgtgctgacatccagatcatatttgattgacagtccacctacttacaatgtgcactat
ggttacaaaagctgggaagccttctccaacctctcctactacaccagggcccttcctccc
gtagcagatgactgcccaactcccatgggtgtgaagggaaataaggagcttcctgattca
aaagaagtgctggaaaaggttcttctacggagagagttcatccctgacccccaaggctca
aatatgatgtttgcattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggacctgggttcacccgaggactgggccatggagtggacttaaatcacatttat
ggtgaaactctggacagacaacataaactgcgccttttcaaggatggaaaattgaaatat
caggtcattggtggagaggtgtatccccccacagtcaaagacactcaggtagagatgatc
taccctcctcacatccctgagaacctgcagtttgctgtggggcaggaagtctttggtctg
gtgcctggtctgatgatgtatgccaccatctggcttcgggagcacaacagagtgtgcgac
atactcaagcaggagcatcctgagtggggtgatgagcaactattccaaaccagcagactc
atactcataggagagactatcaagatagtgatcgaagactacgtgcaacacctgagcggt
taccacttcaaactcaagtttgacccagagctccttttcaaccagcagttccagtatcag
aaccgcattgcctctgaattcaacacactctatcactggcaccccctgctgcccgacacc
ttcaacattgaagaccaggagtacagcttcaaacagtttctctacaacaactccatcctc
ctggaacatggactcactcagtttgttgagtcattcaccagacagattgctggccgggtt
gctgggggaagaaatgtgccaattgctgtacaagcagtggcaaaggcctccattgaccag
agcagagagatgaaataccagtctctcaatgagtaccgcaaacgcttctccctgaagccg
tacacatcatttgaagaacttacaggagagaaggaaatggctgcagaattgaaagccctc
tacagtgacatcgatgtcatggaactgtaccctgccctgctggtggaaaaacctcgtcca
gatgctatctttggggagaccatggtagagcttggagcaccattctccttgaaaggactt
atgggaaatcccatctgttctcctcaatactggaagccgagcacctttggaggcgaagtg
ggttttaagatcatcaatactgcctcaattcagtctctcatctgcaataatgtgaagggg
tgtcccttcacttctttcaatgtgcaagatccacagcctaccaaaacagccaccatcaat
gcaagtgcctcccactccagactagatgacattaaccctacagtactaatcaaaaggcgt
tcaactgagctgtaa

DBGET integrated database retrieval system