KEGG   Mus musculus (mouse): 19229Help
Entry
19229             CDS       T01002                                 

Gene name
Ptk2b, CADTK, CAKB, CAKbeta, E430023O05Rik, FADK2, FAK2, PYK2, Raftk
Definition
(RefSeq) PTK2 protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04062  Chemokine signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04670  Leukocyte transendothelial migration
mmu04912  GnRH signaling pathway
mmu05135  Yersinia infection
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    19229 (Ptk2b)
   04072 Phospholipase D signaling pathway
    19229 (Ptk2b)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    19229 (Ptk2b)
   04670 Leukocyte transendothelial migration
    19229 (Ptk2b)
   04062 Chemokine signaling pathway
    19229 (Ptk2b)
  09152 Endocrine system
   04912 GnRH signaling pathway
    19229 (Ptk2b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    19229 (Ptk2b)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19229 (Ptk2b)
   05161 Hepatitis B
    19229 (Ptk2b)
   05163 Human cytomegalovirus infection
    19229 (Ptk2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     19229 (Ptk2b)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  FAK family
   19229 (Ptk2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 19229
NCBI-ProteinID: NP_001155838
MGI: 104908
Ensembl: ENSMUSG00000059456
Vega: OTTMUSG00000016348
UniProt: Q9QVP9 Q3UDE9 K7QD41
LinkDB All DBs
Position
14 D1; 14 34.36 cM
AA seq 1009 aa AA seqDB search
MSGVSEPLSRVKVGTLRRPEGPPEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIQEIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDTKPTCLA
EFKQIKSIRCLPLEETQAVLQLGIEGAPQSLSIKTSSLAEAENMADLIDGYCRLQGEHKG
SLIMHAKKDGEKRNSLPQIPTLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGV
AREEVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTQDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVPTLVLYTLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPELCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAIEQERNARYRPPKILEPTTFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKIKMKQVLERQQKQMVEDSQWLRREERCLDPMVYMNDKSP
LTPEKEAGYTEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYHNVMTLVEAVLELKNKLGQ
LPPEDYVVVVKNVGLNLRKLIGSVDDLLPSLPASSRTEIEGTQKLLNKDLAELINKMKLA
QQNAVTSLSEDCKRQMLTASHTLAVDAKNLLDAVDQAKVVANLAHPPAE
NT seq 3030 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtgtctgagcccttgagccgtgtaaaagtgggcactttacgccggcctgag
ggccccccagagcccatggtggtggtaccagtggatgtggagaaggaagacgtgcgcatc
ctcaaggtctgcttctacagcaacagcttcaacccagggaagaacttcaagcttgtcaaa
tgcacagtgcagacagagatccaggagatcatcacctccatcctcctgagtgggcgaata
gggcccaacatccagctggctgaatgctatgggctgaggctgaagcacatgaagtcagac
gagatccactggctgcacccacagatgaccgtgggcgaagtgcaggacaagtatgaatgt
ctacacgtggaagctgagtggaggtatgaccttcaaatccgctacttgccggaagacttc
atggagagcctgaaagaagacaggaccacattgctgtacttttatcaacagctccggaat
gactacatgcaacgctacgccagcaaggtcagtgaaggcatggctctgcagctgggctgt
ctggagctcaggagattcttcaaggacatgccccacaatgcactggacaaaaagtccaac
tttgaactcctggaaaaagaagtcggtctggacctgtttttcccaaagcagatgcaggaa
aacttaaagcccaagcagttccggaagatgatccagcagaccttccagcagtatgcatca
ctccgggaggaagagtgtgtcatgaaattcttcaataccctagcgggctttgccaacatt
gaccaggagacctaccgctgcgaactcattcaaggatggaacattactgtggacctggtc
atcggccctaaaggcatccgtcagctgacaagtcaagatacaaagcccacctgcctggcc
gagtttaagcagatcaaatccatcaggtgcctcccattggaagagacccaggcagtcctg
cagctgggcatcgagggtgccccccagtccttgtctatcaaaacgtcgtccctggcagag
gctgagaacatggctgacctcatagatggctactgcaggctgcaaggagaacataagggc
tctctcatcatgcatgccaagaaagatggtgagaagaggaacagcctgcctcagatcccc
acactaaacctggaggctcggcggtcgcacctctcagaaagctgcagcatagagtcagac
atctatgcggagattcccgatgagaccctgcgaagaccaggaggtccacagtacggtgtt
gcccgtgaagaagtagttcttaaccgcattctgggtgaaggcttctttggggaggtctat
gaaggtgtctacacgaaccacaaaggggaaaaaattaatgtggccgtcaagacctgtaag
aaagactgtacccaggacaacaaggagaagttcatgagtgaggcagtgatcatgaagaat
cttgaccaccctcacatcgtgaagctgattggcatcattgaagaggaacccacctggatt
atcatggaactgtatccttatggggagctgggacactacctggaacgaaataaaaactcc
ctgaaggtacccactctggtcctgtacaccctacagatatgcaaagccatggcctatctg
gagagcatcaactgtgtgcacagggatattgctgtccggaacatcctggtggcctctcct
gagtgtgtgaagctgggggactttgggctctcccggtacattgaggacgaagactattac
aaagcctctgtgacccgtctacccatcaaatggatgtcccccgagtccatcaacttccgc
cgcttcacaaccgccagtgatgtctggatgtttgctgtatgcatgtgggagatcctcagc
tttgggaagcagcctttcttctggctcgaaaataaggatgtcatcggagtgctggagaaa
ggggacaggctgcccaagcccgaactctgtccgcctgtcctttacacactcatgactcgc
tgctgggactacgaccccagtgaccggccccgcttcacggagcttgtgtgcagcctcagt
gacatttatcagatggagaaggacattgccatagagcaagaaaggaatgctcgctaccga
ccccccaaaatattggagcctactacctttcaggaacccccacccaagcccagccggccc
aagtacagacctcctccacagaccaacctgctggctcctaagctgcagttccaggtccct
gagggtctgtgtgccagctctcctacgcttaccagccctatggagtatccatctccagtt
aactcgctacacaccccacctctccaccggcacaatgtcttcaagcgccacagcatgcgg
gaggaggacttcatccggcccagtagccgagaagaggcccagcagctctgggaggcagag
aagatcaagatgaagcaggtcctagaaagacagcagaagcagatggtggaagattcccag
tggctgaggcgagaggaaagatgcttggaccctatggtttatatgaatgacaagtcccca
ctgactccagagaaggaggccggctacacggagttcacagggcccccacagaaaccacct
cggctcggtgcacagtccattcagcccacagccaacctggacaggaccgatgacctcgtg
taccacaatgtcatgaccctggtggaggctgtgctggaactcaagaacaagcttggccag
ttgccccctgaggactatgtggtggtggtgaagaacgtggggctgaacctgcggaagctc
atcggcagtgtggacgatctcttgccctccttgccggcatcttcgaggacagagattgaa
gggacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgaagttggct
cagcagaacgccgtgacgtccctgagtgaggactgcaagcggcagatgctcacagcgtcc
cataccctggctgtggatgccaagaacctgctggatgctgtggaccaagccaaggttgtg
gctaatctggcccacccgcctgcagagtga

DBGET integrated database retrieval system