KEGG   Mus musculus (mouse): 19303Help
Entry
19303             CDS       T01002                                 

Gene name
Pxn, AW108311, AW123232, Pax
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04370  VEGF signaling pathway
mmu04510  Focal adhesion
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    19303 (Pxn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19303 (Pxn)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19303 (Pxn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    19303 (Pxn)
   04062 Chemokine signaling pathway
    19303 (Pxn)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19303 (Pxn)
   05203 Viral carcinogenesis
    19303 (Pxn)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    19303 (Pxn)
   05100 Bacterial invasion of epithelial cells
    19303 (Pxn)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19303 (Pxn)
   05163 Human cytomegalovirus infection
    19303 (Pxn)
   05165 Human papillomavirus infection
    19303 (Pxn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Paxillin LIM
Motif
Other DBs
NCBI-GeneID: 19303
NCBI-ProteinID: NP_598676
MGI: 108295
Ensembl: ENSMUSG00000029528
Vega: OTTMUSG00000014676
UniProt: Q8VI36 F8VQ28
LinkDB All DBs
Structure
PDB: 

Position
5 F; 5 56.1 cM
AA seq 591 aa AA seqDB search
MDDLDALLADLESTTSHISKRPVFLSEEPPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TVLDPLDQWQPSGSRYAHQQPPSPLPVYSSSAKNSSASNTQDGVGSLCSRAGEEEHVYSF
PNKQKSAEPSPTVMSSSLGSNLSELDRLLLELNAVQHSPPGFPADEAESSPPLPGALSPL
YGIPENNTPLGGKAGPLVKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSSQQQTRISASSATRELDELMASLSDFKMQGLEQRVDGERPWAASWPPSSR
QSSPEGQDEGGFMAQGKTGSSSPPGGLSKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQSCFVKLFC
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggacgacctcgatgccctgctggcagacttggaatctaccacctcccacatctccaaa
cggccagtgttcttgtcagaggagcccccctactcctacccaactggaaaccacacatac
caggagattgcggtgccacctccggtcccaccaccaccgtccagcgaggccctcaatggc
acggtcctggaccctttagatcagtggcagcctagtggttccagatacgctcaccagcag
cctccgtccccactgcccgtgtacagctccagtgctaaaaattccagtgcctccaacacc
caggacggcgtgggctccctttgttcccgagcaggcgaggaagagcacgtctacagcttc
cccaacaagcagaagtcggcagagccctcacctaccgtcatgagctcctccctgggcagc
aacctctctgaacttgaccggctgttactggagctgaacgcagtgcagcacagcccgcct
ggcttccctgcagatgaagccgaatcgagcccccccttgcctggagccctgagccccctt
tatggcatcccagaaaataacactcccttggggggcaaagcggggcccctggtgaaagag
aagccaaagcgaaatggaggccgggggctggaggatgtgcggcccagcgtggagagcctc
ttggatgaactggagagttccgtgcccagccctgtcccggccatcactgtgaaccaggga
gagatgagcagtccgcagcgagtcacctccagccagcagcagacccggatctcggcctcc
tctgccaccagggagctggacgagctcatggcgtcactgtcagatttcaagatgcagggc
ctggaacagagagtggatggagagcggccgtgggcagccagctggccccccagcagcagg
cagagcagccccgaagggcaggacgagggagggttcatggcccaggggaaaactgggagc
agctcaccccctgggggactctccaagcccgggagccagctggacagcatgttggggagt
ctgcagtccgacctgaacaagctaggggtcgccaccgttgccaaaggggtctgtggagcc
tgcaagaagcccatcgccgggcaggtcgtgaccgccatggggaagacatggcaccccgag
cactttgtgtgcacccactgccaggaggagattggatcccgaaacttttttgagcgggac
ggacagccctactgtgagaaggactaccacagcctcttctccccacgctgctactactgc
aacggacccatcctggataaagtggtgacagcgctggaccgcacatggcacccggaacac
ttcttctgtgcccagtgtggagccttctttggtccagaaggcttccacgagaaggacggc
aaagcgtactgtcgtaaagattacttcgacatgtttgctcccaagtgcggcggctgcgcc
cgtgccatcctggagaactacatttcagccctcaacaccctctggcaccccgaatgcttt
gtgtgcagggagtgcttcacacccttcgtcaacggcagcttctttgagcacgacgggcag
ccgtactgtgaggtccactaccacgagcggcgcggctcgctgtgctccggctgccagaag
cccatcacgggccgctgcatcaccgccatggccaagaagttccaccccgagcatttcgtg
tgcgccttttgcctgaagcagctcaacaagggcaccttcaaggagcagaacgacaaaccc
tactgccagagctgcttcgtgaagctcttctgctag

DBGET integrated database retrieval system