KEGG   Mus musculus (mouse): 19361Help
Entry
19361             CDS       T01002                                 

Gene name
Rad51, AV304093, Rad51a, Reca
Definition
(RefSeq) RAD51 recombinase
  KO
K04482  DNA repair protein RAD51
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
mmu05200  Pathways in cancer
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    19361 (Rad51)
   03460 Fanconi anemia pathway
    19361 (Rad51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19361 (Rad51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    19361 (Rad51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19361 (Rad51)
   04121 Ubiquitin system [BR:mmu04121]
    19361 (Rad51)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19361 (Rad51)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    19361 (Rad51)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    19361 (Rad51)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     19361 (Rad51)
    RecA family proteins
     19361 (Rad51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     19361 (Rad51)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Motif
Other DBs
NCBI-GeneID: 19361
NCBI-ProteinID: NP_035364
MGI: 97890
Ensembl: ENSMUSG00000027323
Vega: OTTMUSG00000015759
UniProt: Q08297
LinkDB All DBs
Position
2 E5; 2 59.92 cM
AA seq 339 aa AA seqDB search
MAMQMQLEASADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGYHTVEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcaaatgcagcttgaagcaagtgcagatacttcagtggaagaagaaagtttt
ggtccacagcctatttcacggttagagcagtgtggcataaatgccaatgatgtgaagaaa
ttagaagaagccggttaccatacagtggaggctgttgcttatgcaccgaagaaggaacta
ataaatattaagggaattagtgaagccaaagctgacaaaattctgactgaggcagcaaaa
ttggttccaatgggtttcaccacggcaactgagtttcaccagcgccggtcagagatcata
cagataactactggctccaaagagctggacaagctgcttcaaggtggaattgagactgga
tctatcacagagatgtttggagaattccgaactgggaagacacagatctgtcatacgttg
gctgttacatgccagctccccattgaccgtggtggaggtgaagggaaggccatgtacatt
gacaccgagggcacctttaggccggagcggctgctagcagtagctgagagatacggtctc
tctggcagcgatgtcctagataatgtagcatatgcgcgagggttcaacacagaccaccag
acccagctcctttaccaagcgtcagccatgatggtagaatccaggtatgcactgcttatt
gtagacagtgctactgccctttacagaacagactactcagggcggggagagctttcagcc
aggcaaatgcatttggccagatttctgaggatgctgcttcgacttgctgatgagtttggt
gtcgcagtggtaatcaccaaccaggtagtagcccaagtagatggagcagccatgttcgct
gcagatcccaaaaaacccattggagggaacatcatcgctcatgcgtcaaccaccaggctg
tacctgagaaaaggaagaggggagaccagaatctgcaaaatctatgactctccctgtctt
cctgaagctgaagctatgtttgccattaatgcagatggagtgggcgatgccaaagactga

DBGET integrated database retrieval system