KEGG   Mus musculus (mouse): 19395Help
Entry
19395             CDS       T01002                                 

Gene name
Rasgrp2, CDC25L, CalDAG-GEFI, Caldaggef1
Definition
(RefSeq) RAS, guanyl releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04611  Platelet activation
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19395 (Rasgrp2)
   04015 Rap1 signaling pathway
    19395 (Rasgrp2)
   04010 MAPK signaling pathway
    19395 (Rasgrp2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19395 (Rasgrp2)
   04062 Chemokine signaling pathway
    19395 (Rasgrp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19395 (Rasgrp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 RasGEF_N EF-hand_8
Motif
Other DBs
NCBI-GeneID: 19395
NCBI-ProteinID: NP_035372
MGI: 1333849
Ensembl: ENSMUSG00000032946
Vega: OTTMUSG00000018627
UniProt: Q9QUG9
LinkDB All DBs
Position
19; 19 A
AA seq 608 aa AA seqDB search
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAERLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KERLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQSVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcactctggacctggacaagggctgcaccgtggaggagctgctccgtggttgc
atcgaagcgtttgatgactccggaaaggtgcgagatccacagctagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccacttctat
cagcaatcccggaaggacaactccaattctctacagatgaaaacgtgtcacttggtcagg
tactggatctcagccttcccagcagagttcgacttgaacccagagctggctgaacagatc
aaggagctgaaggctctgttagaccaagaagggaaccgcaggcacagcagcctcatcgac
atcgagagtgtccctacctacaaatggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccttgttgtttgatcacttggagcctatggagctggcagaa
catcttacctacctggagtatcgttccttctgcaagatcctgttccaagactaccacagc
tttgtgactcatggctgcaccgtagacaacccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacgcacttcgtgcatgtggcagagaggctgctgcagctgcagaacttc
aacacgctgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccacgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctactggcaactacagcaactaccggcgcaggctggcagcctgcgtgggcttccgc
tttcctatcctgggagtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttctgcatt
ctggaggagttggccatggtgaccagccttcgcccacccgtacaagccaaccccgacctg
ctgagcctgctcacggtgtccctggatcagtatcagacagaggatgagctgtaccagctc
tcactgcagcgagagccacgctccaagtcgtcgccaaccagccccaccagctgcaccccg
cctccccggccccctgtgttggaagagtggacctcagttgccaagcctaagctggaccaa
gccttggtggcagagcacattgagaagatggtggagtctgtgttccggaactttgacgtg
gatggggacggtcacatctcccaggaggagtttcagatcatccggggcaacttcccttat
ctcagcgcctttggggacctggaccagaaccaggatggctgcatcagccgggaggagatg
atttcctacttcctgcgctccagctccgtgctgggaggccgcatgggcttcgtacacaac
ttccaggagagtaactcgctacgcccggttgcctgtcgccactgcaaagctctgatcctg
ggcatctacaagcagggccttaaatgtagagcttgtggtgtgaactgccacaagcaatgc
aaagagcgcctgtcagtggaatgtcgccgcagggcccagagtgtcagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttttccctgcctcgc
ccaggcaggcgcagctctcggcctccagagatccgtgaagaggaggtgcagtcggtggag
gacggagtgtttgacatccacttataa

KEGG   Mus musculus (mouse): 19419Help
Entry
19419             CDS       T01002                                 

Gene name
Rasgrp1, Rasgrp, calDAG-GEFII
Definition
(RefSeq) RAS guanyl releasing protein 1
  KO
K04350  RAS guanyl-releasing protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04611  Platelet activation
mmu04660  T cell receptor signaling pathway
mmu05200  Pathways in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19419 (Rasgrp1)
   04010 MAPK signaling pathway
    19419 (Rasgrp1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19419 (Rasgrp1)
   04660 T cell receptor signaling pathway
    19419 (Rasgrp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19419 (Rasgrp1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19419 (Rasgrp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_6 RasGEF_N EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_8 bZIP_1 DivIC
Motif
Other DBs
NCBI-GeneID: 19419
NCBI-ProteinID: NP_035376
MGI: 1314635
Ensembl: ENSMUSG00000027347
Vega: OTTMUSG00000015228
UniProt: Q9Z1S3
LinkDB All DBs
Position
2 E5; 2 59.19 cM
AA seq 795 aa AA seqDB search
MGTLGKAREAPRKPCHGSRAGPKARLEAKSTNSPLPAQPSLAQITQFRMMVSLGHLAKGA
SLDDLIDSCIQSFDADGNLCRNNQLLQVMLTMHRIIISSAELLQKVMNLYKDALEKNSPG
VCLKICYFVRYWITEFWIMFKMDASLTSTMEEFQDLVKANGEETHCHLIDTTQINSRDWS
RKLTQRIKSNTSKKRKVSLLFDHLEPEELSEHLTYLEFKSFRRISFSDYQNYLVNSCVKE
NPTMERSIALCNGISQWVQLMVLSRPTPQLRAEVFIKFIHVAQKLHQLQNFNTLMAVIGG
LCHSSISRLKETSSHVPHEINKVLGEMTELLSSCRNYDNYRRAYGECTHFKIPILGVHLK
DLISLYEAMPDYLEDGKVNVQKLLALYNHINELVQLQEMAPPLDANKDLVHLLTLSLDLY
YTEDEIYELSYAREPRNHRAPPLTPSKPPVVVDWASGVSPKPDPKTISKHVQRMVDSVFK
NYDLDQDGYISQEEFEKIAASFPFSFCVMDKDREGLISRDEITAYFMRASSIYSKLGLGF
PHNFQETTYLKPTFCDNCAGFLWGVIKQGYRCKDCGMNCHKQCKDLVVFECKKRIKSPAI
STENISSVVPMSTLCPLGTKDLLHAPEEGSFIFQNGEIVDHSEESKDRTIMLLGVSSQKI
SVRLKRTVAHKSTQTESFPWVGGETTPGHFVLSSPRKSAQGALYVHSPASPCPSPALVRK
RAFVKWENKESLIKPKPELHLRLRTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLG
KSNHVLAQMDHGDSA
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgggaaccctgggcaaggcgagagaggctccgcggaaaccttgccatggctccagagct
ggccccaaagcaagactagaggccaaatcaaccaacagccctctccctgcccagcccagc
ttggcccagatcacccagttccgaatgatggtgtccctgggacatttggccaaaggagcc
agcctggatgatcttattgacagctgcattcaatcttttgatgcggatggaaacctgtgt
cggaataaccaactgttacaagtcatgctaaccatgcaccggatcatcatctcctcagcc
gagctgctacaaaaagtcatgaatctatataaggatgccctggaaaagaattctccagga
gtttgcctgaagatctgctattttgtcaggtattggataacagaattctggatcatgttc
aagatggatgccagcttgaccagcaccatggaagagttccaagacctggtgaaagccaat
ggtgaggagacccactgccacctcatcgacacgacccaaattaattctcgagactggtcc
aggaaactgactcagaggataaaatcgaatactagcaagaagcgcaaagtgtccctgctg
tttgaccatctggaacctgaagaactgtctgaacacctcacctaccttgagttcaagtcc
ttccgacggatatctttctctgattaccaaaattaccttgtaaatagctgcgtaaaagag
aaccccaccatggagaggtccattgccctgtgcaatggcatctcccagtgggtacaactg
atggttctcagccgtcccaccccgcagctccgggcagaggtcttcatcaagttcatccat
gtggctcagaaactccaccagctacagaacttcaacacgctgatggctgtgatcggggga
ctgtgtcacagctccatctccaggcttaaggaaacaagttcacatgtcccacatgagatc
aataaggttctgggcgagatgactgaactgctgtcctcctgcagaaactatgacaactac
aggcgagcctatggggagtgcacccacttcaaaatccccatactgggtgtgcacctcaag
gacctcatatccctgtatgaggctatgcccgactatctggaagatgggaaggtgaatgtc
caaaagctcctggccctttacaatcatatcaatgaattggtccagctgcaggagatggcc
ccaccattggatgccaacaaggacttggtgcatctgctgacgttatccctggatctatac
tatacagaagatgaaatctatgagctttcctatgcccgggagccgaggaaccacagagct
ccgccactgacaccttcgaagccaccagttgtagtagactgggcctctggagtgtctccc
aaacctgacccaaagaccatcagcaaacacgtccaaaggatggtggattctgtctttaag
aactatgatctcgaccaggatggctatatctctcaggaggagtttgagaagatcgctgca
agctttccattttccttctgtgtgatggacaaagatagggaaggcctcatcagcagagac
gagatcacggcctacttcatgagggccagctccatctattccaagctgggcctgggcttt
ccacacaactttcaagaaaccacttacctgaagcccaccttctgtgacaactgtgctggc
tttctctggggcgtgatcaagcaaggctatcgctgtaaagactgcgggatgaactgccac
aaacagtgcaaagacctggtggtgttcgagtgcaagaagcgaatcaagagcccagcaata
tccacagagaacatcagctctgtggtaccaatgtccaccctttgtccactgggaaccaaa
gatctgctccatgcacccgaagaaggatctttcattttccaaaacggagagattgtggac
cacagtgaggagagcaaggataggaccatcatgctcctcggagtgtcctcccagaaaatt
tcagttcggctgaagaggactgttgcccacaagagcacccaaacagaatcgttcccgtgg
gttggtggcgagacgacccctggtcactttgtgctgtcttctccaaggaagtcggcgcag
ggcgctctttatgtgcacagtccagcatctccatgccccagcccagcactggtccgaaag
cgggcattcgtcaagtgggagaacaaagagtcccttataaaaccaaaaccagaacttcac
ctccggctccggacctaccaagaactggaacaggaaataaataccctgaaagcagataac
gatgctctgaagatccaactgaagtacgcacagaagaaaatagaatccctgcagcttggg
aaaagcaatcatgtcttagcccagatggaccacggtgatagtgcttaa

KEGG   Mus musculus (mouse): 233046Help
Entry
233046            CDS       T01002                                 

Gene name
Rasgrp4
Definition
(RefSeq) RAS guanyl releasing protein 4
  KO
K12363  RAS guanyl-releasing protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    233046 (Rasgrp4)
   04010 MAPK signaling pathway
    233046 (Rasgrp4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    233046 (Rasgrp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 233046
NCBI-ProteinID: NP_660131
MGI: 2386851
Ensembl: ENSMUSG00000030589
Vega: OTTMUSG00000033130
UniProt: Q8BTM9
LinkDB All DBs
Position
7 16.94 cM; 7 B1
AA seq 673 aa AA seqDB search
MNRKDIKRKSHQECSGKAGGRGRSRQARRHKTCPTPREISKVMASMNLGVLSESSCSEDE
LLEECIRCFDSAGSLRRGDHILKMVLTMHSWVLPSSELAARLLTSYQKAAKDAQELRQLQ
ICYLVRYWLTHHHEAVHQEPQLEAVISRFWTTVAQEGNMAQRSLGDASSLLSPGGPGPPP
PMSSPGLGKKRKVSLLFDHLETEELAQHLTYLEFRSFQAITPQDLRGYVLQGSVRGCPAL
EGSVGLSNSVSRWVQVMVLSRPGPAQRAQVLDKFIRVAQRLHQLQNFNTLMAVTGGLCHS
AISRLKDSHVHLSPDSTKALLELTELLSSHNNYAHYRRTWAGCTGFRLPVLGVHLKDLVS
LYEAHPDRLPDGRLHLPKLNSLYLRLQELMALQGQHPPCSANEDLLHLLTLSLDLFYTED
EIYELSYAREPRCPKSLPPSPFKAPVVVEWAQGVTPKPDSVTLGQHVEQLVESVFKNYDP
EGRGSISLEDFERLSGNFPFACHGLHPPPRHGSGSFSREELTKYLLHASAICSKLGLAFL
HAFQEVTFRKPTFCHSCSGFLWGVTKQGYRCRDCGLCCHRHCRDQVRVECKKRPETKGDP
GPPGAPVPATSLPPANCGSEESLSYTLSPDPESGCHLRHAWTQTESSHSSWEPEVVPCPA
RVLPSRASSKPSV
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagacatcaaaaggaagtctcatcaggaatgctctgggaaggcaggaggg
cggggtcggtcacgtcaggcccgccgccacaagacgtgccccaccccccgggaaatcagc
aaggtcatggcgtccatgaatctgggagtgctgagtgagagcagctgcagcgaagatgag
ctattggaggaatgtatccgctgctttgactcggctggcagcctgcgccgaggggaccac
attctcaagatggtgctcacgatgcacagctgggtgctgccatcctcagagctcgctgcc
cgtctgctgacttcgtatcagaaggctgccaaagatgcccaagagctaagacagctacag
atctgttacttggtcaggtactggctgacccatcaccatgaggcagtgcaccaggaaccc
cagctggaagcagtcataagccggttttggaccactgtcgctcaggagggcaacatggcc
caaaggagcctgggagatgcctccagcctgctaagtcctggagggcccggtcccccacct
cccatgagcagcccaggcctgggcaagaagcggaaagtgtcattgctattcgatcacctg
gagacagaggagctggcacaacacctcacttacctggagttccggtctttccaggctatc
acaccccaagacctgcggggctatgttttgcagggttcagtgagaggttgtccagctctg
gaaggttctgtgggtctgagcaacagtgtgtcccgctgggtgcaggtcatggtgctgagt
cgtcctgggcctgcacaacgtgcccaggtcctggacaaattcattcgtgtggcacagagg
cttcaccagctgcagaatttcaacacactgatggcggtcacggggggtctgtgtcatagc
gccatctccagactcaaggactcccacgttcatctgagccctgacagcacaaaggccctg
ctggagctgacagagctcctctcatcccacaacaactatgcccactaccgccgcacctgg
gccggctgtactggcttccggctgccagtactgggtgtgcacctcaaggacctggtatct
ctatatgaggctcatccagacagattgccagatggccgcctgcacctacccaagctgaat
agcctctatctacggctgcaggagctgatggcgctccagggacagcatcctccctgcagt
gccaatgaggacctgctgcacctgctgacgctctccctggatctcttctacacggaagat
gagatctacgagctttcttatgcccgggaaccacgctgtcccaagagtctgccaccgtcc
cccttcaaagcaccagtggtggtagagtgggcccagggtgtgacaccaaagccagacagc
gtgactctgggtcagcatgtggaacagctggtggagtccgtgttcaagaactacgaccca
gaaggccgtggctccatctctctggaggactttgagcggctgtcaggcaacttcccgttc
gcctgccatgggcttcacccacctccccgccatgggagtggctccttcagcagagaggag
ctgaccaagtacctgctccatgccagtgccatctgctccaagctgggcctggccttcctg
cacgccttccaggaggtcaccttccgaaagcccacgttctgtcacagctgcagcggcttc
ctctggggggtcaccaagcaaggctatcgctgtcgggactgtgggctgtgttgtcacaga
cactgcagggatcaagtgagagtggagtgtaagaagaggccagagactaagggtgacccg
ggccccccaggtgcacctgtgccagccacatcacttcctcctgccaactgtggctcagag
gaaagtctctcctatacactctccccggatccggagtctggttgccaccttcgccatgct
tggacccagacggaatcctcacactcttcctgggagccagaggtggtgccctgcccagca
cgggtcttaccatccagagcttcctcgaagcccagcgtctga

KEGG   Mus musculus (mouse): 240168Help
Entry
240168            CDS       T01002                                 

Gene name
Rasgrp3, BC066069, Gm327
Definition
(RefSeq) RAS, guanyl releasing protein 3
  KO
K12362  RAS guanyl-releasing protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04662  B cell receptor signaling pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    240168 (Rasgrp3)
   04015 Rap1 signaling pathway
    240168 (Rasgrp3)
   04010 MAPK signaling pathway
    240168 (Rasgrp3)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    240168 (Rasgrp3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    240168 (Rasgrp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 RasGEF_N
Motif
Other DBs
NCBI-GeneID: 240168
NCBI-ProteinID: NP_001159965
MGI: 3028579
Ensembl: ENSMUSG00000071042
UniProt: Q6NZH9
LinkDB All DBs
Position
17; 17 E2
AA seq 691 aa AA seqDB search
MGSNGLGKAATLDELLSTCIEMFDDNGDLNDSYLPRIVLLMHRWYLSSTELAGKLLCMYR
NASGESCDEFRLKICYFMRYWILKFPAEFNLDLGLIRMTEEFREVASQLGHEKHISLMDI
SSVPSYDWMRRVTQRKKVSKRGKACLLFDHLEPIELAEHLTFLEHKSFRRISFTDYQSYV
IHGCLENNPTLERSIALFNGISKWVQLMVLSKPSAQQRAEVITKFINVAQKLLQLKNFNT
LMAVVGGLSHSSISRLKDTHSHLSSEVTKNWNEMTELVSSNGNYCNYRKAFADCDGFKIP
ILGVHLKDLIAVHVIFPDWMEENKVNVVKMHQLSVTLSELVSLQNASHHLEPNMDLINLL
TLSLDLYHTEDDIYKLSLVLEPRNSKSQPTSPTTPNKPVVPLEWASEVVPKPDPTIINKH
IRKLVESVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
AKSQLHCKMGPGFIHNFQEMNYLKPTFCEHCAGFLWGIIKQGYKCKDCGANCHKQCKDLL
VLACRRLARAPSLSSNPGSLPGSPALPPVQDEVFEFPGVTAGHRDLDSRAITLVTGSSRK
ISVRLQRATTSQATQTEPVWSEAVWGDSGSHTFPKMKSKFHDKAAKDKGFAKWENEKPTV
QAGVDVVDRGTAFEPDQDDGQDEAKQGGEDG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atggggtccaacgggctcgggaaagcggcaacactagatgaacttctcagcacatgcatt
gagatgtttgatgacaatggagacctgaacgacagttacttgcccagaatcgtgttactg
atgcaccgatggtatttatcctccactgaactggcaggaaaactcctctgcatgtatcgg
aatgccagtggagaaagctgtgatgagttccgactgaagatctgctatttcatgaggtac
tggattctgaaatttcctgcagagtttaatttggatcttggtttgattcgcatgactgag
gagttccgggaagtagctagtcaactaggacatgaaaaacacatcagcctcatggacata
tctagcgttccttcctatgactggatgaggagagtcacacagaggaaaaaagtatccaaa
aggggaaaggcctgcctcttatttgaccatctggagcccattgagttggcggagcacctc
acttttctggagcataaatcttttagaaggatctcattcacagattatcagagctatgtc
atccatggctgtctggagaataacccgacattggagagatctattgctttatttaatgga
atctctaagtgggtccagttgatggttcttagcaaaccaagtgcgcaacaaagggcagaa
gtcatcacaaagttcatcaatgtagcccagaaactccttcaactaaaaaattttaacacc
ttgatggcagtggttggtggccttagtcacagctccatttcccgactcaaagacacccat
tctcacctctcttccgaagttacaaagaactggaatgaaatgacagagttggtctcctcc
aatggcaattactgcaattaccgcaaagcctttgctgactgtgatggcttcaaaatcccc
atccttggcgtgcacttgaaagacttgatagcagtccatgtcattttcccagactggatg
gaggagaacaaagtgaacgttgtgaaaatgcaccagctttctgttaccctgagtgaactg
gtctccctgcagaatgcctctcaccacttggaacctaacatggatttgatcaacctactc
actctctctctggacctctaccacacagaggatgatatttacaaactgtcactggtgttg
gagcctagaaattccaaatcgcagccaacctccccaacgacacctaataagcctgtggta
cctctggagtgggcttcagaagtggtaccaaagccagaccccacaatcatcaacaaacac
ataaggaagttggttgagtctgtgtttcgaaactacgatcatgaccacgatggttacatc
tcccaagaggactttgagagcatagctgccaatttccccttcctggattccttctgcgta
ctagacaaagatcaggacggcctaattagcaaagacgaaatgatggcttatttcctgaga
gctaaatctcagctacactgcaaaatgggaccaggcttcatccataattttcaggagatg
aactatctcaagccgaccttctgcgaacactgtgcgggatttctctggggcataatcaaa
caaggctacaagtgcaaagactgtggagccaactgccacaagcagtgcaaagacctcttg
gttctggcctgcaggagacttgccagggcaccctccttgagcagcaaccccgggtcactg
cctggaagcccagccttgcccccagtgcaggatgaggtatttgagtttcctggggtcacg
gctggacaccgagacctggacagcagagccattaccctggttacaggatcttcccggaag
atctccgtgaggctgcagagagccaccactagtcaagccacccagacggaacctgtgtgg
tcagaggctgtctggggagactcagggtcccataccttccccaaaatgaaatccaagttc
catgacaaagcagcaaaggacaagggctttgccaagtgggaaaacgagaagcccacggta
caagctggtgtggatgttgtagatcgaggcactgcatttgaacctgaccaggatgatggg
caagatgaagccaagcagggtggtgaggatggctga

DBGET integrated database retrieval system