KEGG   Mus musculus (mouse): 19645Help
Entry
19645             CDS       T01002                                 

Gene name
Rb1, Rb, Rb-1, pRb, pp105
Definition
(RefSeq) RB transcriptional corepressor 1
  KO
K06618  retinoblastoma-associated protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04110  Cell cycle
mmu04218  Cellular senescence
mmu04934  Cushing syndrome
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    19645 (Rb1)
   04218 Cellular senescence
    19645 (Rb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19645 (Rb1)
   05203 Viral carcinogenesis
    19645 (Rb1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    19645 (Rb1)
   05225 Hepatocellular carcinoma
    19645 (Rb1)
   05226 Gastric cancer
    19645 (Rb1)
   05214 Glioma
    19645 (Rb1)
   05220 Chronic myeloid leukemia
    19645 (Rb1)
   05218 Melanoma
    19645 (Rb1)
   05219 Bladder cancer
    19645 (Rb1)
   05215 Prostate cancer
    19645 (Rb1)
   05224 Breast cancer
    19645 (Rb1)
   05222 Small cell lung cancer
    19645 (Rb1)
   05223 Non-small cell lung cancer
    19645 (Rb1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    19645 (Rb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19645 (Rb1)
   05161 Hepatitis B
    19645 (Rb1)
   05160 Hepatitis C
    19645 (Rb1)
   05163 Human cytomegalovirus infection
    19645 (Rb1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19645 (Rb1)
   05169 Epstein-Barr virus infection
    19645 (Rb1)
   05165 Human papillomavirus infection
    19645 (Rb1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    19645 (Rb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19645 (Rb1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19645 (Rb1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     19645 (Rb1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain Rb
    19645 (Rb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1
Motif
Other DBs
NCBI-GeneID: 19645
NCBI-ProteinID: NP_033055
MGI: 97874
Ensembl: ENSMUSG00000022105
Vega: OTTMUSG00000036132
UniProt: P13405
LinkDB All DBs
Position
14 38.73 cM; 14 D3
AA seq 921 aa AA seqDB search
MPPKAPRRAAAAEPPPPPPPPPREDDPAQDSGPEELPLARLEFEEIEEPEFIALCQKLKV
PDHVRERAWLTWEKVSSVDGILEGYIQKKKELWGICIFIAAVDLDEMPFTFTELQKSIET
SVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALYSKLERTCELIYLTQPSSALSTEIN
SMLVLKISWITFLLAKGEVLQMEDDLVISFQLMLCVVDYFIKFSPPALLREPYKTAAIPI
NGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFINSLGIV
SSNGLPEVESLSKRYEEVYLKNKDLDARLFLDHDKTLQTDPIDSFETERTPRKNNPDEEA
NVVTPHTPVRTVMNTIQQLMVILNSASDQPSENLISYFNNCTVNPKENILKRVKDVGHIF
KEKFANAVGQGCVDIGVQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSL
LACALEVVMATYSRSTLQHLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKVEANLTREM
IKHLERCEHRIMESLAWLSDSPLFDLIKQSKDGEGPDNLEPACPLSLPLQGNHTAADMYL
SPLRSPKKRTSTTRVNSAANTETQAASAFHTQKPLKSTSLALFYKKVYRLAYLRLNTLCA
RLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDLKFKIIVTA
YKDLPHAAQETFKRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPR
SPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQK
INQMVCNSDRVLKRSAEGGNPPKPLKKLRFDIEGADEADGSKHLPAESKFQQKLAEMTST
RTRMQKQRMNESKDVSNKEEK
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaagccccgcgcagagccgcggccgccgagcccccgccaccgccgccgccg
ccgcctcgggaggacgaccccgcgcaggacagcggccccgaagagctgcccctggccagg
cttgagtttgaagaaattgaagaacccgaatttattgcattatgtcaaaagttaaaggta
cccgatcatgtcagagaaagagcttggctaacttgggagaaagtttcatccgtggatgga
atcctggaaggatatattcaaaagaagaaggaactctggggcatctgcatctttatcgca
gcagttgatctagatgagatgccattcacttttactgagctacagaaaagcatagaaacc
agtgtctataaattctttgacttattaaaagaaatcgataccagtaccaaggttgataat
gctatgtcaagactattgaagaagtataatgtgttatgtgcactctacagcaaattagaa
cggacgtgtgaacttatatatttgacacaacccagcagtgcgttatctactgaaataaat
tctatgttggtgctaaaaatttcttggatcacttttttactagctaaaggagaagtatta
cagatggaagatgacctggtaatctcatttcagctaatgttgtgtgtagttgactatttt
attaagttctcacctcctgcactactcagagagccatacaaaacagctgcaatccccatt
aatggttcacctcgaacacccagaagaggtcagaacaggagcgctcggatagcaaaacaa
ctagaaaatgatacgaggattatcgaggttctctgtaaagaacacgagtgtaatatagat
gaggtgaaaaatgtttatttcaaaaattttatcccttttataaattcacttggaattgta
tcatctaatggacttccagaggttgaaagtctttctaaacgctatgaagaagtttatctt
aaaaacaaagatttagatgcaagactgtttttggatcatgataaaacacttcagactgat
cctatagacagttttgaaacagagagaacgccacgaaaaaacaaccctgatgaagaggca
aacgtggttactccacacactccagttaggactgttatgaatactattcaacaattaatg
gtgattttaaattctgcaagtgatcagccatcagaaaatctgatttcctacttcaataat
tgcacagtgaatccaaaagaaaatatcctaaagagagtaaaggatgttgggcacatcttt
aaagagaagtttgctaacgctgtgggccagggctgtgttgacatcggagtacagcgatat
aaacttggagtccgattgtattaccgtgtgatggaatccatgcttaaatcagaagaagaa
cgtttgtccattcagaattttagcaaactcctaaatgacaacatctttcatatgtcttta
ctggcctgtgctcttgaagttgtaatggctacgtatagcagaagtacattgcagcatctt
gattctggaacagatttgtccttcccgtggattctgaacgtacttaatttaaaagccttt
gatttttacaaagtgattgaaagttttatcaaagtggaagccaacttgacaagagaaatg
ataaaacatttagaaagatgtgagcatcgaatcatggaatcccttgcatggctttcagat
tcacctttatttgatctcattaagcagtccaaggatggagaaggacctgataaccttgaa
cctgcttgtcctctcagcctgcctctccagggtaaccatactgcagcagatatgtatctt
tctcctctaagatctccaaagaaaagaacttccactacacgtgtaaattctgctgcaaat
acagagacacaagcagcctcagccttccatactcagaagccattgaaatctacctccctt
gccctgttttacaaaaaagtgtaccgtctagcatatctccgactaaatacactctgtgca
cgccttctgtctgaccacccagagctagagcacatcatctggactctgtttcagcataca
ttgcaaaatgagtatgagctcatgagagaccgacatttggaccagattatgatgtgctct
atgtatggcatctgcaaggtgaagaacatcgacctcaagttcaaaatcatcgtcactgcc
tacaaggatcttcctcacgctgcccaggagacctttaaacgtgttttgatcagagaagag
gagtttgattccattatagtattctataactccgttttcatgcagagactaaaaacaaat
attttacagtatgcctccaccaggcctcctaccttgtcaccaatacctcacattcctcga
agcccttacaagttttctagttcacccttacggattcctggaggtaacatctatatatca
cccctaaagagtccttataaaatttcagaaggtctgccaacacccacaaaaatgactccg
agatcaagaatcttggtctcaattggtgaatcatttgggacatctgaaaagttccagaaa
ataaaccagatggtgtgtaatagtgacagagtgctcaaaagaagtgctgaaggcggcaac
ccccccaaaccactgaaaaagctgcgctttgacatcgagggagccgatgaagcagatggg
agtaaacatctcccagcggagtccaaattccaacagaaactggcagaaatgacttccact
cgaacacgaatgcaaaagcagagaatgaatgagagcaaggatgtctcaaacaaggaggaa
aagtga

DBGET integrated database retrieval system