KEGG   Mus musculus (mouse): 19651Help
Entry
19651             CDS       T01002                                 

Gene name
Rbl2, PRB2, RBR-2, Rb2, p130
Definition
(RefSeq) RB transcriptional corepressor like 2
  KO
K16332  retinoblastoma-like protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu05165  Human papillomavirus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    19651 (Rbl2)
   04151 PI3K-Akt signaling pathway
    19651 (Rbl2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    19651 (Rbl2)
   04218 Cellular senescence
    19651 (Rbl2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    19651 (Rbl2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    19651 (Rbl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19651 (Rbl2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    19651 (Rbl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RB_A RB_B DUF3452 TFIIB DUF5584
Motif
Other DBs
NCBI-GeneID: 19651
NCBI-ProteinID: NP_035380
MGI: 105085
Ensembl: ENSMUSG00000031666
Vega: OTTMUSG00000031746
UniProt: Q64700
LinkDB All DBs
Position
8 C4; 8 44.25 cM
AA seq 1135 aa AA seqDB search
MASGGNQSPPPPPAAAASSEEEEEDGDAADRAQPAGSPSHQIQQRFEELCSRLNMDEAAR
AEAWSSYRSMSESYTLEGNDLHWLACALYVACRKSVPTVSKGTAEGNYVSLTRILRCSEQ
SLIEFFNKMKKWEDMANLPPHFRERTERLERNFTVSAVIFKKYEPIFQDIFKYPQEEQPR
QQRGRKQRRQPCTTSEIFHFCWVLFIYAKGNFPMISDDLVNSYHLLLCALDLVYGNALQC
SNRKELVNPNFKGLSEDCHPKDSKASSDPPCVIEKLCSLHDGLVLEAKGIKEHFWKPYIR
KLFEKKLLKGKEENLTGFLEPGNFGESFKAVNKAYEEYVLAAGNLDERVFLGEDAEEEVG
TLSRCLSAASGTESAERTQMRDILQQHLDKSKALRVCTPLTGVRYVQENSPCVTPVSTAA
HSLSRLHTMLSGLRNAPSEKLERILRSCSRDPTQAIADRLKEMYEIYSQHFQPDENFSNC
AKEIANKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGVLEHDAFHRSLLACCLEVVAFS
HKPPGNFPFIAEIFDVPHYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKTKS
PLWDRIRDNENRVPTCEEVMPPQNLERTDEIYIAGSPLTPRRVGEVRADAGGLGRSITSP
TTLYDRYSSPTVSTTRRRLFENDSPSEGSTSGRIPPQPLVNAVPVQNVPGETVSVTPVPG
QTLVTMATATVTANNGQTVTIPVQGIANENGGITFFPVQVNVGGQAQAVAGSIQPLSAQA
LAGSLSSQQVTGTTLQVPGPVAIQQISPGGQQQNPGQPLTSSSIRPRKTSSLALFFRKVY
YLAGVRLRDLCIKLDISDELRKKIWTCFEFSIIQCTELMMDRHLDQLLMCAIYVMAKVTK
EDRSFQNIMRCYRTQPQARSQVYRSVLIKGKRRNSGSSESRSHQNSPTELNTDRASRDSS
PVMRSNSTLPVPQPSSAPPTPTRLTGASSDVEEEERGDLIQFYNNIYRKQIQAFAMKYSQ
ANAQTDTPPLSPYPFVRTGSPRRVQLSQSHPIYISPHNNEAMPSPREKIFYYFSNSPSKR
LREINSMIRTGETPTKKRGILLDDGSESPAKRICPENHSALLRRLQDVANDRGSQ
NT seq 3408 nt NT seq  +upstreamnt  +downstreamnt
atggcatctggaggcaaccagtcgccaccgcctcctccagctgctgcagccagctcggag
gaagaggaggaggatggcgacgccgcggatcgcgcgcagcccgcggggtccccgagccat
cagatccagcagcggttcgaggagctgtgcagccgcctcaacatggacgaggcggcgcgc
gccgaggcctggagcagctaccgcagcatgagcgagagctacacgctggagggaaatgac
cttcattggttagcatgtgccttatatgtggcttgcagaaaatctgttccaactgtgagc
aaagggaccgctgaaggaaactatgtatctttaaccagaatccttcgctgttcggagcag
agcctaattgaattttttaacaagatgaagaagtgggaagacatggcaaatctgccccca
catttccgagaacgtactgaaagattagaaagaaacttcactgtttctgctgtgattttt
aagaaatatgaacccatttttcaagacatttttaaatatccccaagaagaacagcctcgc
cagcaaagaggaagaaaacagaggcgacagccctgtaccacatcagaaattttccatttt
tgctgggtgctttttatatatgcgaaagggaacttccccatgattagcgatgatctggtc
aattcctaccatcttctgctgtgcgcattagatttagtctatggaaatgcccttcagtgt
tctaaccgtaaagaacttgtgaaccctaattttaaaggcctgtccgaggactgtcacccc
aaggactctaaagcgtcctccgacccgccgtgtgtcattgagaagctgtgctccttacac
gacggtctagtgttggaggccaaggggataaaggaacacttctggaaaccctatattagg
aaactgtttgagaaaaagcttctcaaggggaaggaagaaaatcttactggcttcctggag
cccggaaactttggagagagttttaaggccgttaataaggcatatgaagaatacgtgtta
gccgctgggaatctggatgagcgcgtattccttggtgaggatgctgaggaggaagttggg
actctgtctcggtgtctaagtgctgcctcaggtacagagagtgctgaacggacgcagatg
agagacatcttgcagcagcatcttgacaagtctaaagcacttagagtctgcacaccactg
actggcgtgaggtatgttcaggagaacagcccgtgtgtgactcccgtctccacagctgca
cacagcctgagccgtcttcacaccatgctgtccggcctcaggaatgcacccagtgagaag
ctggagcggatactcaggtcatgttcccgagatccaactcaggctatcgctgacagattg
aaagaaatgtacgaaatatattctcagcatttccagccagatgagaattttagtaattgt
gctaaagaaattgccaacaaacattttcgttttgcagaaatgctctactataaagtatta
gagtctgttattgagcaagaacaaaaaagattgggagacatggatttatctggtgttctg
gagcatgacgcattccacaggtcactcttggcctgctgccttgaggtggtcgctttttcc
cataagcctcctgggaattttccatttattgctgaaatatttgatgtaccacattatcat
ttttataaggtaattgaagtatttattagagcagaagacggtctttgcagagaagtggtc
aaacacctcaatcagattgaagaacaaattttagaccatttggcatggaaaaccaagtcc
ccactgtgggacagaattagagataatgaaaacagagtccctacttgtgaagaggtcatg
ccacctcaaaacctagagagaacagatgaaatttacatcgctggctctcccttaaccccg
agaagggtgggtgaagttcgtgctgatgctggaggacttggaagaagtataacgtctcca
accacattgtatgacaggtacagctccccaacagtcagcactactagaaggcggctattc
gagaatgatagtccctctgaaggaagcacatctgggcgcatccccccacaacccctagtc
aacgctgtccccgtgcagaatgtacctggggagactgtttctgtcacaccagttcctgga
cagaccttggtcaccatggcaacagccactgtcacggccaacaatggacaaacagtgacc
attccagtccaaggtattgccaacgaaaatggagggataaccttcttcccagtccaagtc
aacgttgggggccaggcccaggctgtcgctggctctatccagcccctcagtgctcaagca
ctggctggaagtctgagttcccaacaggtgacaggaaccactttgcaagtccctggtccg
gtggccattcaacagatttcccctggtggacaacagcagaacccaggccagccactaacc
agcagcagtatccggccgcggaagactagctccttagcgctcttctttagaaaggtttac
tacttagccggtgtccgccttcgagatctttgtataaaactagatatttcagatgaactg
aggaaaaaaatttggacctgctttgaattctctataatccagtgcaccgaacttatgatg
gacagacatctggaccagctgttgatgtgtgccatttatgtgatggcaaaggtcacaaaa
gaagacaggtccttccagaacatcatgcgttgttacagaactcagccacaggcccggagc
caggtgtacagaagtgtcttgataaaagggaaaagaagaaactctggcagcagtgagagc
agaagccatcagaattctccaaccgaactaaatacagacagagccagtagagattccagc
ccagtgatgaggtcaaacagcaccctaccagttccacagcccagcagtgcccctcctaca
ccaactcgactcacgggtgccagcagtgacgttgaagaggaggaacgaggagacctcatt
cagttctacaacaacatctataggaagcaaatccaagcgtttgccatgaagtactcgcag
gcaaacgcgcagacggacactcctcccctctctccctatccatttgtaagaacaggctcc
cctcgccgagtacagttatctcaaagtcatcctatctacatttccccacataacaacgaa
gcaatgccttctcctcgagagaagattttttactacttcagcaacagcccatcaaagaga
ctgagggaaatcaacagtatgatacggacaggagagactccaactaaaaagagagggatt
ctcttggacgacggaagtgaatcacctgcaaaaagaatctgcccagagaatcactctgct
ctgttacgtcgtctccaggatgtggcgaatgaccgaggttcacagtga

DBGET integrated database retrieval system