KEGG   Mus musculus (mouse): 19698Help
Entry
19698             CDS       T01002                                 

Gene name
Relb, shep
Definition
(RefSeq) avian reticuloendotheliosis viral (v-rel) oncogene related B
  KO
K09253  transcription factor RelB
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19698 (Relb)
   04064 NF-kappa B signaling pathway
    19698 (Relb)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19698 (Relb)
  09158 Development
   04380 Osteoclast differentiation
    19698 (Relb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19698 (Relb)
   05169 Epstein-Barr virus infection
    19698 (Relb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19698 (Relb)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    19698 (Relb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RelB_transactiv RHD_DNA_bind RHD_dimer RelB_leu_zip
Motif
Other DBs
NCBI-GeneID: 19698
NCBI-ProteinID: NP_033072
MGI: 103289
Ensembl: ENSMUSG00000002983
Vega: OTTMUSG00000020490
UniProt: Q04863
LinkDB All DBs
Structure
PDB: 

Position
7 A3; 7 9.93 cM
AA seq 558 aa AA seqDB search
MPSRRAARESAPELGALGSSDLSSLSLTVSRTTDELEIIDEYIKENGFGLDGTQLSEMPR
LVPRGPASLSSVTLGPAAPPPPATPSWSCTLGRLVSPGPCPRPYLVITEQPKQRGMRFRY
ECEGRSAGSILGESSTEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKD
CTDGVCRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVD
MNVVRICFQASYRDQQGHLHRMDPILSEPVYDKKSTNTSELRICRINKESGPCTGGEELY
LLCDKVQKEDISVVFSTASWEGRADFSQADVHRQIAIVFKTPPYEDLEISEPVTVNVFLQ
RLTDGVCSEPLPFTYLPRDHDSYGVDKKRKRGLPDVLGELSSSDPHGIESKRRKKKPVFL
DHFLPGHSSGLFLPPSALQPADSDFFPASISLPGLEPPGGPDLLDDGFAYDPSAPTLFTM
LDLLPPAPPLASAVVGSGGAGATVVESSGPEPLSLDSFAAPGPGDVGTASLVGSNMFPNQ
YREAAFGGGLLSPGPEAT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtcgccgcgctgccagagagtccgcgcccgagctaggggccttgggttccagt
gacctctcttccctgtcactaacggtctccaggaccacagatgaattggaaatcatcgac
gaatacattaaggagaacggctttggcctggacgggacacagctgagtgagatgccgcgc
ctggtgccccgcgggcccgcctcactgagcagcgtcacgctgggccctgctgcaccaccg
cctccggccacgccgtcctggagctgcacactgggcaggctggtgtcacccggcccgtgc
ccacggccgtacctggtcatcacagagcagccaaagcagcgtggcatgcgcttccgctac
gagtgcgagggccgctcggccggcagcatcctcggggagagcagcaccgaagccagcaag
accctgcccgccatcgagcttcgagactgtggcgggctgcgggaggtggaggtgacggcg
tgcctggtgtggaaggactggccacaccgggtacacccacatagcctcgtggggaaagac
tgcacggacggcgtctgcagggtgcggctgcggcctcacgtcagcccccggcacagcttt
aacaacctgggcatccagtgtgttaggaagaaggaaattgaagctgccattgagcggaag
atccagctgggaattgacccctacaatgctggctccctgaagaaccatcaggaggtcgac
atgaatgtcgtcaggatctgcttccaggcctcctatcgggaccagcagggacatctgcac
cgcatggaccccatcctctctgagcctgtctacgacaagaagtccaccaacacatcggag
ctgcggatttgccgaatcaacaaggagagcgggccgtgcacaggtggtgaggagctgtac
ttgctctgtgacaaggtgcaaaaagaggacatatccgtggtgttcagcacagcttcctgg
gaaggccgtgccgacttctctcaagctgatgtgcaccggcagatcgccattgtgttcaaa
acgccaccctacgaggacctggagatctcagagcccgtgactgtcaatgtgttcttgcag
cggctcacggatggggtgtgcagcgagccgctgcccttcacgtacctgcctcgggatcat
gacagctacggtgtggacaagaagcgaaagcggggactgcctgatgtccttggagagttg
agcagctctgatccacatggaatcgagagcaaacgaaggaaaaagaaaccagtgttcttg
gaccacttcctgcctggccacagctcaggcctgttcctcccaccatcggctctgcagccg
gcagactctgatttcttccctgcttccatatcccttcctgggctggagcctcctggtgga
cccgatctcctggacgatggctttgcctatgatccttctgcccccacgctcttcactatg
ttggacctgctgcccccagcaccaccacttgccagtgctgtggtgggtagcgggggtgca
ggggccaccgttgtggagtcttctggcccagagcccctatcactggactcttttgcagcg
ccgggccccggggatgttggtactgctagccttgtgggcagcaacatgtttcccaaccag
taccgagaggcagctttcgggggtggcctcctatctccagggcctgaagccacgtag

DBGET integrated database retrieval system