KEGG   Mus musculus (mouse): 19712Help
Entry
19712             CDS       T01002                                 

Gene name
Rest, 2610008J04Rik, AA407358, NRSF, REST4
Definition
(RefSeq) RE1-silencing transcription factor
  KO
K09222  RE1-silencing transcription factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    19712 (Rest)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    19712 (Rest)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19712 (Rest)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    19712 (Rest)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-H2C2_5 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_2
Motif
Other DBs
NCBI-GeneID: 19712
NCBI-ProteinID: NP_035393
MGI: 104897
Ensembl: ENSMUSG00000029249
Vega: OTTMUSG00000021414
UniProt: Q8VIG1
LinkDB All DBs
Position
5; 5 C3.3
AA seq 1082 aa AA seqDB search
MATQVMGQSSGGGSLFNNSANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASG
SCCDYLVGEERQMAELMPVGDNHFSESEGEGLEESADLKGLENMELGSLELSAVEPQPVF
EASAAPEIYSANKDPAPETPVAEDKCRSSKAKPFRCKPCQYEAESEEQFVHHIRIHSAKK
FFVEESAEKQAKAWESGSSPAEEGEFSKGPIRCDRCGYNTNRYDHYMAHLKHHLRAGENE
RIYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCSKCNYFSDRKNNYVQHVRTHTGERPYK
CELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCNYVASNQHEVTRHARQVHNGPKPLNCPH
CDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPSKTMDVSKV
KLKKTKKREADLLNNAVSNEKMENEQTKTKGDVSGKKNEKPVKAVGKDASKEKKPGSSVS
VVQVTTRTRKSAVAAETKAAEVKHTDGQTGNNPEKPCKAKKNKRKKDAEAHPSEEPVNEG
PVTKKKKKSECKSKIGTNVPKGGGRAEERPGVKKQSASLKKGTKKTPPKTKTSKKGGKLA
PKGMGQTEPSSGALAQVGVSPDPALIQAEVTGSGSSQTELPSPMDIAKSEPAQMEVSLTG
PPPVEPAQMEPSPAKPPQVEAPTYPQPPQRGPAPPTGPAPPTGPAPPTEPAPPTGLAEME
PSPTEPSQKEPPPSMEPPCPEELPQAEPPPMEDCQKELPSPVEPAQIEVAQTAPTQVQEE
PPPVSEPPRVKPTKRSSLRKDRAEKELSLLSEMARQEQVLMGVGLVPVRDSKLLKGNKSA
QDPPAPPSPSPKGNSREETPKDQEMVSDGEGTIVFPLKKGGPEEAGESPAELAALKESAR
VSSSEQNSAMPEGGASHSKCQTGSSGLCDVDTEQKTDTVPMKDSAAEPVSPPTPTVDRDA
GSPAVVASPPITLAENESQEIDEDEGIHSHDGSDLSDNMSEGSDDSGLHGARPTPPEATS
KNGKAGLAGKVTEGEFVCIFCDRSFRKEKDYSKHLNRHLVNVYFLEEAAEEQEEQEEREE
QE
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atggccacccaggtgatggggcagtcttctggaggaggcagtctcttcaacaacagtgcc
aacatgggcatggccttaaccaacgacatgtacgacctgcacgagctctcgaaagctgaa
ctggcagcccctcagctcatcatgttagccaacgtggccctgacgggggaggcaagcggc
agctgctgcgattacctggtcggtgaagagaggcagatggccgaattgatgcccgtggga
gacaaccacttctcagaaagtgaaggagaaggcctggaagagtcggctgacctcaaaggg
ctggaaaacatggaactgggaagtttggagctaagtgctgtagaaccccagcccgtattt
gaagcctcagctgccccagaaatatacagcgccaataaagatcccgctccagaaacaccc
gtggcggaagacaaatgcaggagttctaaggccaagcccttccggtgtaagccttgccag
tacgaagccgaatctgaagagcagtttgtgcatcacatccggattcacagcgctaagaag
ttctttgtggaggaaagtgcagagaaacaggccaaagcctgggagtcggggtcgtctccg
gccgaagagggcgagttctccaaaggccccatccgctgtgaccgctgtggctacaatacc
aaccggtatgaccactacatggcacacctgaagcaccacctgcgagctggcgagaacgag
cgcatctacaagtgcatcatctgcacgtacacgacggtcagcgagtaccactggaggaaa
cacctgagaaaccatttccccaggaaagtctacacctgcagcaagtgcaactacttctca
gacagaaaaaataactacgttcagcacgtgcgaactcacacaggagaacgcccgtataaa
tgtgaactttgtccttactcaagctctcagaagactcatctaacgcgacacatgcggact
cattcaggtgagaagccatttaaatgtgatcagtgcaattatgtggcctctaatcagcat
gaagtgacccgacatgcaagacaggttcacaacgggcctaaacctcttaattgcccgcac
tgtgactacaaaacagcagatagaagcaacttcaaaaagcacgtggagctgcatgttaac
ccacggcagttcaactgccccgtgtgtgactacgcggcttctaagaagtgtaatctacaa
taccatttcaaatctaagcatcccacctgtcccagcaaaacaatggatgtctccaaagtg
aagctaaagaaaaccaaaaagagagaggctgacctgcttaataacgccgtcagcaacgag
aagatggagaatgagcaaacaaaaacaaagggggatgtgtctgggaagaagaacgagaaa
cctgtaaaagctgtgggaaaagatgcttcaaaagagaagaagcctggtagcagtgtctca
gtggtccaggtaactaccaggactcggaagtcagcggtggcggcggagactaaagcagca
gaggtgaaacacacagacggacaaacaggaaacaatccagaaaagccctgtaaagccaag
aaaaacaaaagaaagaaggatgctgaggcccatccctccgaagagcctgtgaacgaggga
ccagtgacaaaaaagaaaaagaagtctgagtgcaaatcaaaaatcggtaccaacgtgcca
aagggcggcggccgagcggaggagaggccgggggtcaagaagcaaagcgcttcccttaag
aaaggcacaaagaagacgccgcccaagacaaagacaagtaaaaaaggtggcaaacttgct
ccaaaggggatggggcagacagaaccttcttctggggcattggctcaagtgggggtgtct
ccagaccctgccctcattcaggcagaggtcaccgggtcaggatcttctcagacagagctt
ccttcacccatggatattgctaagtcagagcccgcccagatggaggtttccctaacaggg
ccacctccggtggagcctgctcaaatggagccatcgcctgcgaaacctccccaggtagaa
gcacccacttacccccagcctccccaaagggggcctgcccctcccacggggcctgcccct
cccacggggcctgcccctcccacggagcctgcccctcccacggggcttgccgagatggaa
ccttctcccacggagccttcccagaaggaaccacctcccagtatggagcctccctgcccc
gaggagctgcctcaggccgagccacctcctatggaggattgtcagaaggagctgccttct
cccgtggagcccgctcagattgaggttgctcagacggcccctacgcaggttcaggaggag
ccccctcctgtctcggagccacctcgggtgaagccaaccaaaagatcatctctccggaaa
gacagagcagagaaggagctgagcctgctgagtgagatggcgcggcaggagcaggtcctc
atgggggttggcttggtgcctgttagagacagcaagcttctgaagggaaacaagagcgcc
caggaccccccagccccaccgtcaccatcgccaaagggaaactcgagggaagagacaccc
aaggaccaagaaatggtctctgatggggaaggaactatagtattccctctcaagaaagga
ggaccagaggaagctggagagagtccagctgagttggctgctctcaaggagtctgcccgt
gtttcatcctctgaacaaaactcagccatgccagagggtggagcatcacacagcaagtgt
cagactggctcctctgggctttgtgacgtggacactgagcagaagacagatactgtcccc
atgaaagactccgcagcagagccagtgtcccctcctaccccaacagtggaccgtgacgca
gggtcaccagctgtagtggcctcccctcctatcacgttggctgaaaacgagtctcaggaa
attgatgaagatgaaggcatccatagccatgatggaagtgacctgagtgacaacatgtct
gaggggagtgacgactcaggactgcacggggctcggccgacaccaccagaagctacgtca
aaaaatgggaaggcagggttggctggtaaagtgactgagggagagtttgtgtgtattttc
tgtgatcgttcttttagaaaggaaaaagattatagcaaacacctcaatcgccacttggtg
aatgtgtacttcctagaagaagcagctgaggagcaggaggagcaggaggagcgggaggag
caggagtag

DBGET integrated database retrieval system