KEGG   Mus musculus (mouse): 19713Help
Entry
19713             CDS       T01002                                 

Gene name
Ret, PTC, RET51, RET9, c-Ret
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19713 (Ret)
   05230 Central carbon metabolism in cancer
    19713 (Ret)
  09162 Cancer: specific types
   05216 Thyroid cancer
    19713 (Ret)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19713 (Ret)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     19713 (Ret)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   19713 (Ret)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin RIO1 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 19713
NCBI-ProteinID: NP_033076
MGI: 97902
Ensembl: ENSMUSG00000030110
Vega: OTTMUSG00000056769
UniProt: P35546
LinkDB All DBs
Position
6 F1; 6 55.86 cM
AA seq 1115 aa AA seqDB search
MAKATSGAAGLGLKLILLLPLLGEAPLGLYFSRDAYWERLYVDQPAGTPLLYVHALRDAP
GEVPSFRLGQHLYGVYRTRLHENDWIRINETTGLLYLNQSLDHSSWEQLSIRNGGFPLLT
IFLQVFLGSTAQREGECHWPGCTRVYFSFINDTFPNCSSFKAQDLCIPETAVSFRVRENR
PPGTFYHFHMLPVQFLCPNISVKYSLLGGDSLPFRCDPDCLEVSTRWALDRELREKYVLE
ALCIVAGPGANKETVTLSFPVTVYDEDDSAPTFSGGVGTASAVVEFKRKEGTVVATLQVF
DADVVPASGELVRRYTNTLLSGDSWAQQTFRVEHSPIETLVQVNNNSVRATMHNYKLILN
RSLSISESRVLQLAVLVNDSDFQGPGAGGILVLHFNVSVLPVTLNLPRAYSFPVNKRARR
YAQIGKVCVENCQEFSGVSIQYKLQPSSINCTALGVVTSPEDTSGTLFVNDTEALRRPEC
TKLQYTVVATDRQTRRQTQASLVVTVEGTSITEEVGCPKSCAVNKRRPECEECGGLGSPT
GRCEWRQGDGKGITRNFSTCSPSTRTCPDGHCDAVESRDANICPQDCLRADIVGGHERGE
RQGIKAGYGICNCFPDEKKCFCEPEDSQGPLCDALCRTIITAALFSLIISILLSIFCVCH
HHKHGHKPPIASAEMTFCRPAQGFPISYSSSGTRRPSLDSTENQVPVDSFKIPEDPKWEF
PRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASQSELRDLLSEFNLL
KQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRKIGPAYVSGGGSRNSSSLD
HPDERVLTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDV
YEEDSYVKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPER
LFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLA
ASTPSDSLLYDDGLSEEETPLVDCNNAPLPRSLPSTWIENKLYGMSDPNWPGESPVPLTR
ADGTSTGFPRYANDSVYANWMVSPSAAKLMDTFDS
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagcgacgtccggcgccgcagggctggggctgaagctgattttgctcctgccg
ctgctaggagaagccccactgggcctctatttctcaagggatgcttactgggagaggctg
tatgtagaccagccagctggcacacctctgctctatgtccatgccctacgggatgcccct
ggagaagtgccgagcttccgcctgggccagcatctctatggcgtctaccgtacacggctg
catgagaatgactggatccgcatcaatgagactactggccttctctacctcaatcagagc
ctggaccacagttcctgggaacagctcagcatccgcaatggtggtttccccctgctcacc
atcttcctccaggtctttctggggtccacagcccagagagagggagaatgccattggcca
ggctgtacccgtgtgtacttctccttcatcaacgacaccttcccaaattgtagctccttc
aaagcccaggatctctgcatcccagagacagccgtgtccttccgagtcagggagaacagg
cctcctggcaccttctaccacttccacatgttacccgtgcagttcctttgtcccaacatc
agtgtgaagtacagtctcttaggaggggatagtctgcccttccgttgtgacccagactgc
ctggaggtgagcactcgctgggccctggatcgagagctccgggagaagtatgtgctggag
gctttgtgcatagtggcaggccctggtgccaacaaagagacggtgactctgtccttccca
gtgacagtgtatgatgaggacgactcggcgcccaccttctctggaggtgtgggcactgcc
agcgcggtggtggagtttaagcggaaggagggcactgtggtggccaccctgcaggtgttc
gatgcagatgtggtgccagcgtctggggagctggtgagacggtacacaaacacactcctc
tcaggggactcctgggcccagcagaccttccgggtggagcattcgcccatcgagaccttg
gtccaggtcaacaacaactccgttcgggcaaccatgcacaattacaagctgattctcaac
aggagcctgtctatctcagagagccgagtcctgcagctcgcggtcctggtcaacgactca
gacttccaggggcctggggcaggtggtatcctcgtcctccatttcaacgtgtctgtactg
cccgtcaccctgaacctacccagggcctactccttcccagtgaataagagggcccgccgc
tatgcccagatcgggaaagtctgtgtggaaaactgccaggagttcagcggtgtctccatc
cagtacaagctgcagccttccagcatcaactgcactgccctaggtgtggtcacctcaccc
gaggacacctcggggaccctatttgtaaatgacacagaggccctgcggcgacctgagtgc
accaagcttcagtacacggtggtagccactgaccggcagacccgcagacagacccaggct
tcgctagtggtcactgtggaggggacatccattactgaagaagtaggctgccccaagtcc
tgtgcagtaaacaagaggcgccccgagtgtgaggaatgtggtggcctgggttctccaact
ggcaggtgcgagtggcgccagggagatggtaaagggatcaccaggaacttctccacctgc
tcccccagtaccaggacctgccccgacggccactgtgatgctgtggagagccgggatgcc
aacatttgcccccaggactgtctccgtgccgacattgttggaggacacgagcgaggggag
cgccagggcattaaagcaggctacggcatctgcaactgtttccctgatgagaagaaatgc
ttctgcgagccagaggacagccagggcccactgtgtgatgcgctgtgccgcacgatcatc
acagctgccctcttctcccttatcatctccatcctgctgtccatcttctgtgtctgccac
caccacaagcatgggcacaagccgcccattgcatcagcggaaatgaccttctgccggccg
gcccagggcttcccaatcagttattcctcctcaggcacccgccggccctcactggattcc
acggagaaccaggttcctgtggactctttcaagatcccggaggatccaaagtgggaattt
cctcggaagaacttagttcttgggaaaactctgggagaaggcgagtttggaaaagttgtc
aaggccacagccttccgtctgaaaggccgggcaggatacaccacagtggctgtgaaaatg
ctgaaagaaaacgcctcccagagtgagttacgagacctgctgtctgagttcaaccttctg
aaacaagtcaaccatccacatgtcatcaagttgtatggggcctgcagccaggatgggcca
cttcttctcattgtggagtatgccaagtatggctccctgcggggattcctccgtgacagc
cgcaagattgggcctgcctatgtgagcggtggaggcagccgcaactccagctcgctggac
cacccagatgaaagggtactgaccatgggtgacctcatctccttcgcctggcagatctcg
aggggtatgcagtacttggcagaaatgaagcttgtacatcgggacttagctgccaggaac
atcttggtggctgagggacggaagatgaagatttccgactttgggctgtcccgagatgtt
tatgaggaagattcctatgtgaagaaaagcaagggccggattcccgtcaagtggatggca
attgagtcccttttcgatcacatctatactactcaaagtgatgtgtggtcctttggagtg
ctgctctgggagattgtgaccctgggaggcaacccctaccctggaattcctcctgaacga
ctcttcaaccttctgaagacaggccacaggatggagaggccagacaactgcagcgaggaa
atgtaccgtctgatgctgcagtgctggaagcaggagccagacaagaggccagtgtttgct
gacatcagcaaggatctggagaagatgatggtcaagagcagagactacttggacctggct
gcatccacaccttcggactcactgctgtatgacgatgggctctcagaagaggagacaccc
ctggtggactgtaacaatgctcccctcccgcgctccctcccttccacatggattgaaaac
aaactctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgaga
gccgatggcactagcactgggttcccaagatatgcaaatgatagtgtatatgctaactgg
atggtttcaccctcagcggcaaaattaatggacacatttgatagctaa

KEGG   Mus musculus (mouse): 27057Help
Entry
27057             CDS       T01002                                 

Gene name
Ncoa4, ARA70, Rfg
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04216  Ferroptosis
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    27057 (Ncoa4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    27057 (Ncoa4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    27057 (Ncoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARA70 CARD
Motif
Other DBs
NCBI-GeneID: 27057
NCBI-ProteinID: NP_001029160
MGI: 1350932
Ensembl: ENSMUSG00000056234
Vega: OTTMUSG00000036491
UniProt: Q5U4H9
LinkDB All DBs
Position
14; 14 B
AA seq 625 aa AA seqDB search
MNTSLEQSGCYSNRETLLRCSDARRELELAIGGVLRAEQQIKDNLREVKAQIHSCISRHL
ECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEYTQNKDLANQVSV
CLERLGSLALKPEDSTVLLFEADTSALRQTITTFGSLKTIQIPEHLMAHASSSSIGPFLE
KRGYIQVPEQKSASSGTAVSLSEWLLVSKPAIGLQAPYVPSTNPQDWLIPKQTSENSQTS
ARACSFFSDAWGNLKGLENWLLNSHQQEIAGKPSSSKCNSHCSTSSFSPEAEKAEDVELL
DQDELDLSDWLVTPQEPCELEKPVDGSWETSEKFKLLFQVFREPYNVSDWLVKPDSCTNC
QGNQPRGVEIENLGNLKCLNDHLEAKKSVSVPGATISDGWLAQNHQDTWKVEEVCKANEP
CTSFAECVCDDNCEKEAMYKWLLKKGGKDKNGMPMEPKSEPEKHRESLTLWLCPSRNELT
EQAKAPKAMAPARIADSFHVIKNSSLSEWLMGPTCKGGPKDVPNTEERAGKEMLQSSMAT
SWCPFNTADWVLPGKKVGSLSQFPSGEDKWLLRKKAQEAFLNSPLQEERNFRPDCYGLPA
VCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgaacacatccctggaacagagtggctgctacagtaatagagaaactcttctgaggtgc
agtgatgcaaggagggagctggagcttgctattggtggagtacttcgggctgaacagcaa
attaaagataatttacgagaggtaaaagctcagattcacagctgcataagtcgccacctg
gaatgccttcggagccgagaggtgtggctcaatgaacaggtcgatctcatctatcagctt
aaagaggagacactgcagcagcaggctcagcagctctattggctaatgggccaattcaat
tgtcttattcatcaactggagtatactcagaacaaagatcttgccaatcaagtctctgtg
tgcttggagagactgggcagtttggccctgaagcctgaagattcaactgtcctactcttt
gaagcagatacatctgctctgcgccagaccatcaccacatttggatcccttaagaccatt
caaatccctgagcatctgatggctcacgcgagctcctcaagtattgggcctttcctagag
aaaagaggctatatccaggtgccagagcagaagtcagcatccagtggcacagctgtatct
ctgagtgagtggcttcttgtaagcaaacctgccattggtcttcaggctccttatgtaccc
agtaccaacccacaggactggcttatcccaaaacagacttcagagaatagtcagacttct
gccagagcctgcagtttcttcagcgatgcctggggcaatctgaagggcttagaaaattgg
ctccttaacagtcatcaacaagaaattgctggaaaaccaagttcctcaaaatgtaacagc
cattgtagcaccagttctttctctcctgaagctgaaaaggctgaagatgtagagctcctt
gatcaagacgagctggacctgtctgattggttggtgactcctcaggaaccctgtgagctg
gagaagcctgtggatggcagctgggaaaccagcgagaagtttaaactcttgttccaggtg
ttcagagagccctacaatgtgagtgattggcttgtcaagcctgactcctgtaccaactgt
cagggcaaccagcctagaggtgtggagattgagaacctgggcaatctgaaatgcctaaat
gaccacttggaggccaaaaaatcagtgtcggtccccggcgcaacaatcagcgacggctgg
cttgcccagaaccatcaggacacatggaaagtagaggaagtgtgtaaagccaacgagccc
tgcaccagttttgcagagtgtgtgtgtgatgacaactgtgagaaggaagccatgtataaa
tggcttctgaagaagggaggaaaggacaagaatggaatgcctatggaacctaaatctgag
cctgagaaacacagagagtccctgacactgtggctctgcccttccagaaatgagctaaca
gaacaagctaaggcacccaaggctatggctcctgctagaattgctgattccttccacgtc
ataaagaatagttccttgtcagagtggcttatggggcctacgtgcaaaggaggccctaag
gacgtgcctaatacagaggagagagctggcaaagagatgcttcaaagctccatggccact
tcctggtgtccctttaacactgccgactgggttttaccaggaaagaaagtgggaagcctc
agccagttcccctctggagaagataagtggctacttcgaaagaaggcacaggaagcattt
cttaattcacccctacaagaagaacgtaactttcgccccgactgttacggcctcccagca
gtttgtgatctctttgcctgtatgcagcttaaggttgataaagaaaaatggctgtacaga
actcctctacagatgtga

KEGG   Mus musculus (mouse): 76551Help
Entry
76551             CDS       T01002                                 

Gene name
Ccdc6, 2810012H18Rik, AA536681, AA960498, AW061011
Definition
(RefSeq) coiled-coil domain containing 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    76551 (Ccdc6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    76551 (Ccdc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF2046
Motif
Other DBs
NCBI-GeneID: 76551
NCBI-ProteinID: NP_001104591
MGI: 1923801
Ensembl: ENSMUSG00000048701
Vega: OTTMUSG00000032767
UniProt: D3YZP9
LinkDB All DBs
Position
10; 10 B5.3
AA seq 469 aa AA seqDB search
MADSASESDTDAAGGGPAAMQSSCSATSGGSGGGGGGKSGGIVISPFRLEELTNRLASLQ
QENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEK
ETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTIS
KQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRD
ISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRK
LQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPIS
PGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSSSPDKFKRPT
PPPSPNTQSPVQPPPPPPPPPMQPAVPSAAPTQPAPTQPQHPVHPSSQP
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgcgagcgagagcgacacggacgcggcgggcggcggcccggcagccatg
cagtcgtcctgctcggcgacctcgggcggcagcggcgggggcggcggcgggaagtcgggg
ggcattgtcatctcgccgttccgcctggaggagctcaccaaccgcctggcctcgctgcag
caggagaacaaggtgctcaagatagagctggagacctacaaactcaagtgcaaggcgctg
caggaggagaaccgcgacctgcgcaaagccagcgtgaccatccaagccagggctgagcag
gaagaagaattcatcagtaacactttattcaagaaaatccaggccttgcagaaggagaaa
gaaaccctcgccgtgaattacgagaaggaagaggagtttctcaccaatgagctctcccgg
aaactgatgcagctgcagcatgagaaggcggagctggaacaacacctggagcaggaacag
gagtttcaggtcaacaagctgatgaagaagatcaaaaagctggagaacgacaccatctcc
aagcaactcaccttagagcagctgagacgggagaagattgacctggaaaacacactggag
caagagcaggaggcgctggtgaatcggctgtggaagaggatggataagctggaagctgag
aagagaatcctacaggagaaattagaccagcctgtgtctgccccaccatcgcctagagac
atctccatggagatcgattcccccgagaacatgatgaggcatatcaggtttttaaagaac
gaagtggagcgactgaagaagcagctacgagccgcccagttacaacactcggagaagatg
gcccagtacttggaggaggagcggcacatgagggaagagaacctgcggctacagcggaag
ctccagagggagatggagaggagggaagcgctgtgtcgccagctctcggagagcgagtcc
agcctggagatggatgatgagaggtattttaatgagatgtctgcacaaggattgagacct
cgcactgtgtccagcccaatcccttacacgccttctcccagctcaagcagacctatatca
cccggtctttcgtatgcaagtcacacggttggcttcacaccgccaacgtcgttgactaga
gctggaatgtcctactacaactctccgggcctccacgtgcagcacatgggggcctcccac
ggcatcacaaggccatcgccacggagaagcagcagccctgacaagtttaaacggcccacg
ccgcctccgtctcccaacacacagagcccggtccaaccgcctccgccgccgccaccacct
cccatgcagcccgcggtcccctcggcagcccccacgcaacccgcccccacgcagcctcag
catccggtgcacccctcctcccagccttaa

DBGET integrated database retrieval system