KEGG   Mus musculus (mouse): 19730Help
Entry
19730             CDS       T01002                                 

Gene name
Ralgds, Gnds, Rgds, mKIAA1308
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19730 (Ralgds)
   04015 Rap1 signaling pathway
    19730 (Ralgds)
   04072 Phospholipase D signaling pathway
    19730 (Ralgds)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19730 (Ralgds)
   05231 Choline metabolism in cancer
    19730 (Ralgds)
  09162 Cancer: specific types
   05210 Colorectal cancer
    19730 (Ralgds)
   05212 Pancreatic cancer
    19730 (Ralgds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF RasGEF_N RA
Motif
Other DBs
NCBI-GeneID: 19730
NCBI-ProteinID: NP_033084
MGI: 107485
Ensembl: ENSMUSG00000026821
Vega: OTTMUSG00000011643
UniProt: Q03385 Q6ZPU1
LinkDB All DBs
Position
2; 2 A3
AA seq 852 aa AA seqDB search
MMVDCQSSTQEIGEELINGVIYSISLRKVQLHQGATKGQRWLGCENESALNLYETCKVRT
VKAGTLEKLVEHLVPAFQGSDLSYVTVFLCTYRAFTTTQQVLDLLFKRYGRCDALTASSR
YGCILPYSSEDGGPQDQLKNAISSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGS
DLERRAHLLLAQLEDLEPSEAESEALSPAPVLSLKPASQLEPALLLTPSQVVTSTPVREP
AAAPVPVLASSPVVAPAPELEPVPEPPQEPEPSLALAPELEPAVSQSLELESAPVPTPAL
EPSWSLPEATENGLTEKPHLLLFPPDLVAEQFTLMDAELFKKVVPYHCLGSIWSQRDKKG
KEHLAPTIRATVAQFNNVANCVITTCLGDQSMKAPDRARVVEHWIEVARECRALKNFSSL
YAILSALQSNAIHRLKKTWEEVSRDSFRVFQKLSEIFSDENNYSLSRELLIKEGTSKFAT
LEMNPRRAQRRQKETGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVI
AQIKLLQSACNNYSIAPEEHFGTWFRAMERLSEAESYTLSCELEPPSESASNTLRSKKST
AIVKRWSDRQAPSTELSTSSSAHSKSCDQLRCSPYLGSGDITDALSVHSAGSSSSDVEEI
NMSFVPESPDGQEKKFWESASQSSPETSGISSASSSTSSSSASTTPVSTTRTHKRSVSGV
CSYSSSLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPTVIRKAMDKHNLDEDE
PEDYELVQIISEDHKLKIPENANVFYAMNSTANYDFILKKRTFTKGAKVKHGASSTLPRM
KQKGLRIAKGIF
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgatggtagattgccagagctccacgcaggagattggggaggagctgatcaacggggtc
atctactccatctccctgcgcaaggtccagctacaccaaggagccactaagggccagcgc
tggctagggtgtgagaacgagtcggctctgaacctctatgagacctgcaaggtgcgcacg
gtgaaggctggtactctggagaagctggtggaacacctggtgcctgccttccagggcagt
gacctttcctacgtcactgtcttcctgtgcacctacagagccttcactaccacccagcag
gtgctagacctgctgttcaaaaggtacggtagatgtgacgccctcacggcctcctctaga
tatggctgcatcctcccctactccagtgaggacggcggaccgcaggaccaactcaaaaat
gccatctcctccatcctgggcacctggctggaccaatactcagaggatttctgtcaacct
ccggactttccctgcctcaagcagctggtggcttatgtacagctcaacatgcctggctca
gatctggagcgccgcgctcaccttctcctggcccagctggaggacctggagcccagtgag
gctgagtctgaggccctgtccccagctccagtgctgtctctgaagccagcttcacagcta
gaacctgcactgctgctgacgcccagccaagtggtgacatcaactccagtacgagagccc
gctgcggccccagtgccagtgctggcctccagcccagtggtggcaccagctcctgagcta
gaaccagttccagagccacctcaagagcctgagccatccctagcactggctccagagctg
gagcccgccgtctcacagagcctggaactggagtcagctcctgtgcccactcctgcctta
gagccttcctggtctctgcctgaagccacggagaatggactaaccgagaagcctcacctt
ctgctgttccctcctgacttggtggctgaacagtttactctgatggatgcagaactattc
aagaaagtcgtgccctaccactgcctgggctccatctggtcccaacgggacaagaagggc
aaggagcacctcgcgcctaccatccgcgccactgtcgcccagttcaacaacgtggccaac
tgtgtcattactacctgccttggggaccagagtatgaaggctccggacagggcccgggtg
gtggaacactggatcgaggtggccagggagtgcagagcgctcaagaatttctcctccctc
tacgccatcctctctgctctacagagcaatgccatccaccgcctaaagaagacgtgggaa
gaggtctccagggacagctttcgagtgttccagaaactgtcggagatcttctctgatgag
aacaactactccctgagcagagagctgctcatcaaggaaggaacctccaagtttgccaca
ctggagatgaaccctaggagagcccagaggcggcagaaggagacaggagtcatccagggc
accgttccctacctgggcacattcctcactgacctggtgatgctggacactgccatgaag
gactatctctatgggagactgatcaactttgaaaagagaaggaaggagttcgaagtcatt
gcccagatcaagttgctacagtcagcctgcaacaactacagcattgctccggaagaacac
tttggaacatggttccgagctatggagcgactcagtgaggctgagagctacaccctgtcg
tgtgagctggagcccccgtctgagtcggccagcaacaccctgaggagcaagaaaagcaca
gccattgtcaagcgctggagcgaccgccaggctcccagcacggagctcagcaccagtagc
agtgcccactccaagtcctgtgaccagcttcggtgcagcccttacctcggcagcggggac
atcaccgacgcgctcagtgtgcactcagctggctcttccagctctgatgtggaggagatc
aacatgagcttcgtcccagagtctcctgatggccaggaaaagaagttctgggagtcagcc
tcccagtcgtccccagagacctctggcatcagctccgcctccagcagcacctcctcttcg
tcagcctccaccacgcccgtgtctaccacgcgcacccacaagcgctccgtctcaggggtc
tgcagctacagctcctcactgcctctctacaaccagcaggtgggcgactgctgcatcatc
agggtcagcctggatgtggacaacggcaacatgtacaagagcatcctggtgaccagccag
gataaggctccgactgtcatccgaaaagccatggacaaacacaacctagatgaggacgag
ccggaggattatgagctggtgcagatcatctcagaggatcacaagctgaagattccagaa
aacgccaatgtgttctatgccatgaactctaccgccaactatgacttcatcctaaagaag
cggaccttcactaagggggctaaagtcaagcatggagccagctccaccctccctcgtatg
aagcagaagggactcaggattgccaaaggcatcttctaa

DBGET integrated database retrieval system