KEGG   Mus musculus (mouse): 19744Help
Entry
19744             CDS       T01002                                 

Gene name
Rheb, Rheb1
Definition
(RefSeq) Ras homolog enriched in brain
  KO
K07208  Ras homolog enriched in brain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04218  Cellular senescence
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    19744 (Rheb)
   04151 PI3K-Akt signaling pathway
    19744 (Rheb)
   04152 AMPK signaling pathway
    19744 (Rheb)
   04150 mTOR signaling pathway
    19744 (Rheb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19744 (Rheb)
  09143 Cell growth and death
   04218 Cellular senescence
    19744 (Rheb)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19744 (Rheb)
   04919 Thyroid hormone signaling pathway
    19744 (Rheb)
  09149 Aging
   04211 Longevity regulating pathway
    19744 (Rheb)
  09159 Environmental adaptation
   04714 Thermogenesis
    19744 (Rheb)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    19744 (Rheb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    19744 (Rheb)
   05163 Human cytomegalovirus infection
    19744 (Rheb)
   05165 Human papillomavirus infection
    19744 (Rheb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:mmu04031]
    19744 (Rheb)
GTP-binding proteins [BR:mmu04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    19744 (Rheb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB
Motif
Other DBs
NCBI-GeneID: 19744
NCBI-ProteinID: NP_444305
MGI: 97912
Ensembl: ENSMUSG00000028945
Vega: OTTMUSG00000023527
UniProt: Q921J2 Q540E6
LinkDB All DBs
Structure
PDB: 

Position
5; 5 A3
AA seq 184 aa AA seqDB search
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS
CSVM
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagtccaagtcccggaagatcgccatcctgggctaccggtctgtgggaaagtcc
tcattgacaattcagtttgttgaaggccaatttgttgattcctacgatccaaccatagag
aacacgttcaccaagttgatcacggtaaatggtcaagagtatcatcttcagcttgtagac
acagcggggcaggatgaatattccatttttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagttttgaagtaattaaagttatccat
ggcaagttgttggatatggtggggaaagtgcagatacctattatgttggttggaaataag
aaggacctgcatatggaaagggtgatcagctatgaagaaggaaaggctttggcagaatct
tggaatgcagcttttttggaatcttctgctaaagaaaatcaaactgctgttgatgttttt
aaaaggataattttggaagcagaaaagattgatggagcagcttcacaaggaaagtcttcg
tgctcggtgatgtga

DBGET integrated database retrieval system