KEGG   Mus musculus (mouse): 19765Help
Entry
19765             CDS       T01002                                 

Gene name
Ralbp1, RLIP76, Rip1
Definition
(RefSeq) ralA binding protein 1
  KO
K08773  RalA-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu05200  Pathways in cancer
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    19765 (Ralbp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19765 (Ralbp1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    19765 (Ralbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19765 (Ralbp1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    19765 (Ralbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGAP Nod1
Motif
Other DBs
NCBI-GeneID: 19765
NCBI-ProteinID: NP_001185878
MGI: 108466
Ensembl: ENSMUSG00000024096
UniProt: Q62172
LinkDB All DBs
Position
17 E1.1; 17 35.26 cM
AA seq 648 aa AA seqDB search
MTECFLPPSSSPSEHRRAEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDVLHEPPDT
VSDDDKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKVKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
MDAPSVKPIFGVPLVDAVERTMMYDGVRLPAVFRECVDYMEKHGMKCEGVYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGKTTEMEKV
QEFQRLLRELPECNHLLLSWLIVHLDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVL
FTHVQELFGTVVLKQVTRPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIDRLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQLILEDLQRQNEELEIKNNHLNQAVHEEREAIIELRVQLRLLQMQRAK
SEQQPQEEEEPERRGGIGPPPCDGVLEVRVAKEQAKASPSKDRKETPI
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgactgagtgcttcctgcccccgagcagcagccctagtgaacaccgcagggccgagcat
ggcagcgggctgacccggacccccagctctgaggagatcagtcctacaaagttccctgga
ttgtaccggacaggcgagccctcgcctccccatgacgtcctccatgagcctcctgataca
gtgtcagatgacgacaaagaccatggaaagaaaaaagggaaatttaagaaaaaggagaaa
aggactgaaggctacgctgccttccaggaagacagctctggagatgaagctgaaagtcct
tccaaggtgaagaggtccaagggaatccatgtgttcaaaaagcccagtttctctaaaaag
aaggaaaaagattttaaaatcaaagaaaaacccaaagaagaaaagcataaagaagaaaag
cacaaagaggaaaagcataaagaaaagaaatcgaaagacttgacagcagctgatgttgtt
aaacagtggaaggaaaagaagaaaaagaaaaagccaattcaggagccagaggtgcctcag
atggacgcaccgagtgtcaagcccatttttggggttcccttggttgacgcagtagagagg
accatgatgtacgacggcgtccggctgccagctgtcttccgggagtgtgtggactacatg
gagaagcacggcatgaagtgtgaaggcgtctaccgggtgtcaggaatcaaatcaaaggta
gatgagctaaaagcagcctatgaccgagaggagtctccaaacttagaagaatatgagcct
aacactgtagccagcttgctgaagcagtatttgcgagaccttccagagaatttgcttacc
aaagagcttatgccccggtttgaagaggcttgtgggaagaccacagagatggagaaagtg
caggaattccagcgcttgctccgggaactgccggagtgcaatcatcttctgctttcctgg
ctcattgtgcacctggaccacgtcattgcgaaggagctggaaacgaagatgaacatccag
aacatctctatagtgctgagccccaccgtgcagatcagcaatcgggtcctgtacgtgctt
ttcacacatgtgcaagagctctttggcaccgtggtcctgaagcaagtaacaagacctctg
cgctggtccaacatggccacgatgcccacactgccagagacccaagcaggcatcaaggag
gagatcaggagacaggagttccttttgaattgtttacatcgagatctgcagggcgggata
aaggacttatctaaagaagaaagattatgggaagtacagaggattctgactgccctcaag
agaaagctgagggaagctaaaagacaagagtgtgaaaccaagattgcacaggagatagct
agtctttcaaaagaggatgtttccaaagaagaaatgaatgaaaacgaagaagttataaat
atccttcttgcccaggagaatgaaatcctgacagaacaggaggagctcctggccatggag
cagttcctgcgtcgtcagatcgcctcagagaaagaagagatcgaccgcctccgagctgaa
attgcggagatccagagccgtcagcagcatggccgcagtgagacggaggagtactcgtcc
gacagcgagagtgagagcgaggacgaggaggagctgcagctcatcctggaggacctgcag
cggcagaacgaggagttagaaataaagaacaatcacttgaaccaagcagtccatgaggag
cgggaggccatcatcgagctccgagtgcagctccggctgctccagatgcagcgagccaag
tctgagcagcagccgcaggaggaggaggagcccgagaggcgagggggcataggcccaccg
ccctgtgacggtgtcctcgaggtgcgggtagccaaggagcaggcgaaggcctcgcccagc
aaagaccggaaggagacgcccatctga

DBGET integrated database retrieval system