KEGG   Mus musculus (mouse): 20185
Entry
20185             CDS       T01002                                 

Gene name
Ncor1, 5730405M06Rik, A230020K14Rik, N-, N-CoR, RIP13, Rxr, Rxrip13, mKIAA1047
Definition
(RefSeq) nuclear receptor co-repressor 1
  KO
K04650  nuclear receptor co-repressor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04919  Thyroid hormone signaling pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    20185 (Ncor1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    20185 (Ncor1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    20185 (Ncor1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20185 (Ncor1)
SSDB
Motif
Pfam: GPS2_interact Myb_DNA-binding Myb_DNA-bind_6
Other DBs
NCBI-GeneID: 20185
NCBI-ProteinID: NP_001239242
MGI: 1349717
Ensembl: ENSMUSG00000018501
Vega: OTTMUSG00000005855
UniProt: Q5RIM6
LinkDB
Position
11; 11 B2
AA seq 2454 aa
MSSSGYPPNQGAFSTEQSRYPSHSVQYTFPSTRHQQEFAVPDYRSSHIEVSQASQLLQQQ
QQQQQLRRRPSLLSEFHPGSDRPQERRTGYEQFHSGPSPVDHDSLESKRPRLEPVSDAHF
QRVSAAVLPLVHSLPEGLRSSADAKKDSAFGSKHEAPSSPLAGQPCGDDQNASPSKLSKE
ELIQSMDRVDREIAKVEQQILKLKKKQQQLEEEAAKPPEPEKPVSPPPVEQKHRSIVQII
YDENRKKAEEAHKIFEGLGPKVELPLYNQPSDTKVYHENIKTNQVMRKKLILFFKRRNHA
RKQREQKICQRYDQLMEAWEKKVDRIENNPRRKAKESKTREYYEKQFPEIRKQREQQERF
QRVGQRGAGLSATIARSEHEISEIIDGLSEQENNEKQMRQLSVIPPMMFDAEQRRVKFIN
MNGLMEDPMKVYKDRQFMNVWTDHEKEIFKDKFIQHPKNFGLIASYLERKSVPDCVLYYY
LTKKNENYKALVRRNYGKRRGRNQQIARPSQEEKVEEKEEDKAEKTEKKEEEKKDDEEKD
DKEDSKETTKEKDRTEATAEEPEEREQVTPRGRKTANSQGRRKGRVTRSMTSEAAAANAA
AAATEEPPPPLPPPPEPISTEPVETSRWTEEEMEVAKKGLVEHGRNWAAIAKMVGTKSEA
QCKNFYFNYKRRHNLDNLLQQHKQKASRKPREERDVSQCESVASTVSAQEDEDIEASNEE
ENPEDSEGAENSSDTESAPSPSPVEAAKSSEDSSENAASRGNTEPVAELEATTDPAPCAS
PSSAVPTTKPAERESVEAQVTDSASAETAEPMDVDHEECGAEGSSVLDPPAPTKADSVDP
EMQVPENTASKGEGDAKERDLESTSEKTEARDEDVVVAEQIERPEPQSDDDSSATCSADE
GVDGEPERQRVFPMDAKPSLLTPPGSILISSPIKPNPLDLPQLQHRAAVIPPMVSCTPCN
IPIGTPVSGYALYQRHIKAMHESALLEEQRQRQEQVDLECRSSTSPCSTSKSPNREWEVL
QPAPHQVITNLPEGVRLPTTRPTRPPPPLIPSSKTTVASEKPSFIMGGSISQGTPGTYLS
SHNQAYPQEAPKPSVGSISLGLPRQQESTKAAPLTYIKQEEFSPRSQNSQPEGLLVRAQH
EGVVRGTAGAVQEGSITRGTPASKISVETISSLRGSITQGTPALPQAGIPTEALVKGPVS
RMPIEESSPEKVREEAASKGHVIYEGKSGHILSYDNIKNAREGTRSPRTAHEMSLKRSYE
AVEGSIKQGMSMRESPVSAPLEGLICRALPRGSPHSDLKERTVLSGSIMQGTPRATAESF
EDGLKYPKQIKRESPPIRAFEGAITKGKPYDGITTIKEMGRSIHEIPRQDILTQESRKTP
EVVQSTRPIIEGSISQGTPIKFDNNSGQSAIKHNVKSLITGPSKLPRGMLEIVPENIKVV
ERGKYEDVKAGEPVRARHTSVVSSGPSVLRSTLHEAPKAQLSPGLYDDSSARRTPVSYQN
TISRGSPMMNRTSDVSSSKSASHERKSTLTPTQRESIPAKSPVPGVDPVVSHSPFDPHHR
SSAAGEVYRSHLPTHLDPAMPFHRALDPAAAYLLQRQLSPTPGYPSQYQLYAMENTRQTI
LNDYITSQQMQVNLRPDVTRGLSPREQPLGLPYPATRGIIDLTNMPPTILVPHAGGTSTP
PMDRITYIPGTQVTFPPRPYNAASLSPGHPTHLAAAASAEREREREREKERERERERERE
RERERIAAAPADLYLRPGSEQPGRPGSHGYVRSPSPSVRTQETILQQRPSVFQGTNGTSV
ITPLDPTAQLRIMPLPSGGPSISQGLPASRYNTAADALAALVDAAASAPQMDVSKTKESK
HEAARLEENLRSRSAAVSEQQQLEQKNLEVEKRSVQCVCTSSALPSGKAQPHASVVYSEA
GKDKGPPPKSRYEEELRTRGKTTITAANFIDVIITRQIASDKDARERGSQSSDSSSSLSS
HRYETASDAIEVISPASSPAPPQEKPQAYQPDMVKANQAENESTRQYEGPLHHYRSQQES
PSPQQQPPLPPSSQSEGMGQVPRTHRLITLADHICQIITQDFARNQVPSQPSTSTFQTSP
SALSSTPVRTKTSSRYSPESQSQTVLHPRPGPRVSPENLVDKSRGSRPGKSPERSHIPSE
PYEPISPPQGPAVHEKQDSMLLLSQRGVDPAEQRSDSRSPGSISYLPSFFTKLESTSPMV
KSKKQEIFRKLNSSGGGDSDMAAAQPGTEIFNLPAVTTSGAVSSRSHSFADPASNLGLED
IIRKALMGSFDDKVEDHGVVMSHPVGIMPGSASTSVVTSSEARRDEGEPSPHAGVCKPKL
INKSNSRKSKSPIPGQSYLGTERPSSVSSVHSEGDYHRQTPGWAWEDRPSSTGSTQFPYN
PLTIRMLSSTPPTQIACAPSAITQAAPHQQNRIWEREPAPLLSAQYETLSDSDD
NT seq 7365 nt   +upstreamnt  +downstreamnt
atgtcaagttcaggttaccctcccaaccaaggagctttcagcacagagcaaagtcgttat
ccttcacattctgtccagtatacctttcccagtacccgacaccagcaggaatttgcagtt
cctgactaccgctcttctcatattgaagttagccaggcatcacagcttttacagcagcag
cagcagcagcagcagcttcgaagacgaccttccttgctttcagaatttcacccgggttct
gacaggcctcaagaaaggagaactggatatgaacagtttcactcaggaccctcaccggtg
gatcatgattccttggagtccaagcgcccacgcctggagccagtttctgatgcccatttc
cagcgtgttagtgctgcggttttacctttagttcactcgctgccagaaggcttgaggtcg
tctgcagatgctaagaaggattcagcatttggaagcaaacatgaagctccatcctctcct
ttggctgggcaaccatgtggagatgaccaaaatgcttcaccttcaaagctttcaaaggag
gagttaatacagagtatggaccgggtagaccgagagattgcaaaagtagagcagcagatc
cttaaattgaaaaagaaacaacaacagctagaagaagaagcagctaagccccctgaacca
gagaagcctgtgtcccctcctcctgtggaacaaaaacaccgtagtattgtccaaattatt
tatgatgagaatcggaaaaaagcagaagaagctcataaaatatttgaaggtcttggccca
aaagttgaactgccactctataaccagccatcagataccaaggtgtaccatgagaacatc
aagacaaaccaggtgatgaggaaaaaactcattttattttttaaaagaagaaatcatgca
agaaaacaaagggaacaaaaaatctgccagcgctatgatcagctcatggaagcgtgggag
aaaaaagtggacagaatagaaaataatccccggaggaaagcaaaagaaagcaaaacaagg
gaatactatgagaagcagtttccagaaattcgaaaacaaagagaacagcaagaaagattt
cagcgagttggtcagaggggagctggtctttcagccaccattgctaggagtgagcatgag
atttctgaaattattgatggtctttctgaacaggagaataatgagaagcaaatgcgtcag
ctttctgtgattccacctatgatgtttgatgcagaacaaagaagggtcaaattcatcaat
atgaatgggctgatggaggatccaatgaaggtttataaagacagacagtttatgaatgtt
tggactgaccatgaaaaggagatctttaaggacaagtttatccagcatccaaaaaacttt
ggactaattgcatcctatttggaaaggaagagtgttcctgattgtgttttatattactat
ttaaccaagaaaaatgagaattataaggccctcgtgagaaggaattatggaaaacgcaga
ggcagaaatcagcagattgcccgtccctcacaagaagaaaaagtagaagaaaaggaagag
gataaagcagaaaaaacagagaaaaaggaagaagaaaagaaggatgatgaagaaaaagat
gataaggaagactctaaagaaacaaccaaggaaaaggacagaacggaagccacagcagaa
gaacctgaagaaagagagcaggtcactccaagggggcgaaagactgctaacagccaaggc
cgccggaagggccgggtcaccaggtcgatgacaagtgaagctgcagctgccaatgctgct
gctgcagccactgaggagcccccgccacccctgccgccaccaccagagcccatttctaca
gaacctgttgagacttcaagatggacagaagaagaaatggaagttgctaaaaaaggcctg
gtagaacatggtcgtaactgggcagccattgctaaaatggtgggaactaaaagtgaagcc
cagtgcaaaaacttctattttaactataaaagacggcataatcttgacaaccttttgcag
caacataaacagaaagcttcacggaaaccccgtgaggaacgagatgtatctcagtgtgaa
agtgttgcttccactgtttctgcccaagaggatgaagatattgaagcctcaaatgaggag
gaaaatccagaagatagtgaaggtgctgaaaatagttctgatacagaaagtgctccctct
ccttcaccagttgaagctgccaagtccagtgaagacagcagtgaaaatgctgcttctcga
ggaaacaccgagcctgtggctgagcttgaggccaccactgaccctgcaccctgtgcatct
ccctcttcagcagttccaaccacaaaaccagcagaaagggaaagcgtggaggcccaggtg
accgacagcgccagtgctgagaccgcagagccgatggacgtagaccatgaggagtgcggt
gccgagggcagttctgttcttgatccaccagcccctaccaaagccgactccgtggaccca
gaaatgcaggtaccagaaaatactgcgtctaaaggtgaaggggatgccaaggaaagagac
ttggagagcaccagtgagaagacagaggctagagatgaagacgtggtagtggctgaacag
atcgagaggcctgagccacagtcagacgacgactccagtgccacttgcagtgcggatgag
ggtgtggatggagagccagagaggcagagagtgtttcccatggatgcaaagccttcattg
ttaactcctcctggatctatcctaatctcatcccctattaaaccaaacccattggatctg
ccacagcttcagcatcgagctgctgttattccaccaatggtttcttgcactccatgtaat
ataccaattggaacgcccgtaagtggctatgctctttaccaacggcacattaaggccatg
catgagtcagcactcctggaggagcagcggcagaggcaagaacaggtagacttggaatgc
agaagctctacaagcccatgcagcacttctaagagtccaaacagggagtgggaagtcctc
caacctgctccgcatcaagtgataactaaccttcctgaaggggttcggcttccaacaaca
cgaccaaccaggccaccacctcccctcatcccatcatctaaaaccacagtggcatcagaa
aaaccatcctttataatgggagggtctatctcacagggaactcctggcacttacttgtct
tctcataatcaggcttatccacaagaagcccctaagccctccgtggggtctatctctctg
ggattgccccggcagcaggagtctaccaaagcagctcctttgacctacatcaagcaggaa
gaattttctccgagaagccaaaactcacaacctgagggtttattggtcagagcgcagcat
gaaggtgtggtcagaggcactgcaggggctgtccaagaaggaagtataactcggggaact
ccagccagcaaaatctcagtggagaccatttcatcgttgcggggctctattacccagggg
accccagctctgccccaggctggaataccaacagaggctttggtgaagggacctgtctcc
aggatgcctattgaagaaagcagtcctgagaaggtcagagaggaagctgcatccaagggc
catgttatctatgaaggcaaaagtggacatatcttatcatatgataatattaagaatgcc
cgagaagggactcggagtccaagaacagctcatgaaatgagtttaaaaagaagctatgag
gcagtggaaggaagtataaagcaaggcatgtcgatgagggagtctcctgtgtcagcacct
ttagagggtctgatatgccgagcattacccagggggagccctcattctgacctcaaagag
aggactgtgctgtctggttccataatgcagggcacaccaagagccacagcggaaagcttt
gaggacggccttaaataccccaaacagataaaaagggagagccctcccatccgagcattt
gaaggtgccattaccaaaggaaaaccatacgatggtatcaccaccatcaaagaaatgggg
cgctccatccatgaaatcccacggcaagatattctaactcaggaaagccggaaaactcca
gaagtggtccagagcacgaggccaataattgagggttccatttcccagggcacaccaata
aaatttgacaacaactcaggtcaatcagctatcaaacacaatgtgaagtccttaatcaca
gggcctagcaaactaccccgtggaatgctggaaattgtaccagagaacataaaagtagta
gaacggggaaaatatgaggatgtgaaagcaggcgagccagtgcgagcccggcacacgtca
gtggtgagctctggcccctccgttctcaggtctacacttcacgaagctcccaaagcacag
ctgagcccgggactctatgatgacagcagcgctcgcaggactcctgtgagctaccagaac
accatatccagaggctcccccatgatgaacagaacttctgatgtttcttccagcaagtct
gccagtcatgaaaggaaatcaactctgaccccaacccaaagagaaagtataccagccaag
tctccagtgcccggggtggatcccgtcgtgagtcacagcccatttgatcctcatcacagg
agtagcgctgcaggagaggtttatcggagccacctacccacgcacttggatccagctatg
ccctttcacagggctttggatcctgctgctgcttacctgttacagagacagctttcacca
accccaggatacccaagtcagtaccagctctatgcaatggagaatacaaggcagacaatc
ctcaacgattacattacctcacagcagatgcaggtgaatctgcgccctgatgtcaccagg
ggactgtccccacgagagcagccactggggctcccttacccagctacaagaggaatcatt
gacctgaccaatatgcctccaacaatcttagtgcctcatgcagggggaacgagcacccct
cccatggacaggatcacgtatattcctggtacacaggttactttccctcccaggccatat
aacgctgcttctctgtctccaggacacccaacacaccttgcagcagctgcaagtgctgag
agggaacgagagcgggaaagggagaaggagcgcgaacgtgagcgcgagcgtgagcgtgaa
cgtgaacgcgaaaggatcgctgctgctcccgctgacctctacctacgaccaggttcagaa
cagccaggccgtcctggcagccacggatatgttcgctccccttccccttcagtaagaact
caggagaccatcctgcaacagagacccagtgttttccagggcaccaatggaaccagtgta
atcacacctttggacccaactgctcagctacgcatcatgccactgccttctgggggccct
tccataagtcaaggcctgccagcctcccgttacaacactgctgcggatgccctggctgct
cttgtggatgctgcagcttctgcaccccagatggatgtttccaaaacaaaagagagtaag
catgaagctgccaggttagaagaaaatttgagaagcaggtcagcagcagttagtgaacag
cagcagctagagcagaaaaacctggaggtggagaagagatctgttcagtgtgtgtgcact
tcttcagcccttccaagtggcaaggcccagcctcatgcctcagtagtgtattctgaggct
gggaaagataaagggcctcctccaaaatccagatatgaggaagagctaaggacccgaggg
aagactaccattactgcagctaacttcatagacgtgatcatcacccggcaaattgcctcg
gacaaggatgcgagggaacgtggctctcaaagttcagactcttctagtagcttgtcttct
cacaggtatgaaacggctagtgatgccattgaggtgataagtcccgccagctcacctgca
ccaccccaggaaaagccacaggcctatcagccagacatggttaaggcaaatcaagcagaa
aatgagtccactcgacagtatgaaggtccactgcatcattatcggtcccagcaggaatca
ccatctccacagcaacagccaccactgcccccatcttcccagtcagagggaatgggacag
gtgcccaggacccatcgactgatcacacttgctgaccacatctgtcaaattatcacacaa
gattttgctagaaatcaagttccctcgcagccttctacttctacattccaaacttcacca
tctgctttgtcatccacacctgtaagaactaaaacctcaagccgctacagcccagaatca
cagtctcagactgtcttgcatcccagaccaggtcctagagtctctccagaaaatcttgtg
gataaatcccggggaagcaggcctggaaaatctccagagaggagtcatatcccatcagag
ccctatgagcccatctccccaccccaaggccctgctgtgcatgagaagcaggacagcatg
ttgctcttgtcacagaggggagtggaccctgctgagcaaaggagtgattctcgatcacca
ggaagtataagctacttgccttcattcttcaccaagcttgaaagcacatcacccatggtt
aaatcaaagaaacaggaaatttttcgtaagttgaactcttctggtggaggtgactctgat
atggcagctgctcagccaggaacagagatcttcaatctgccagcagttaccacatcaggt
gcagtgagctcaagaagccattcttttgctgatcccgccagtaaccttggtctagaagac
atcatcagaaaggctctcatgggaagttttgatgataaagttgaagatcatggtgttgtc
atgtcccatcctgtgggcattatgcctggtagtgccagcacctcagtggtgacgagcagc
gaggcacggagagatgaaggggagccatcacctcatgcaggagtatgcaaaccaaagctg
atcaacaaatcaaacagcaggaagtctaaatctcctattcctgggcaaagctatttagga
actgaaaggccttcttctgtctcctctgtgcattcagaaggtgattaccacaggcagaca
ccaggatgggcatgggaagatcggccctcttcaacaggttctactcagttcccttacaac
cctctgaccatacggatgctcagcagtacaccacctacacagatcgcatgcgccccatct
gccatcacccaagcagctccacatcaacagaaccgcatctgggagagggagcctgccccg
ctcctctcagcgcagtatgagacactgtctgatagtgacgactga

DBGET integrated database retrieval system