KEGG   Mus musculus (mouse): 20191Help
Entry
20191             CDS       T01002                                 

Gene name
Ryr2, 9330127I20Rik, RYR-2
Definition
(RefSeq) ryanodine receptor 2, cardiac
  KO
K04962  ryanodine receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04713  Circadian entrainment
mmu04911  Insulin secretion
mmu04921  Oxytocin signaling pathway
mmu04972  Pancreatic secretion
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    20191 (Ryr2)
   04020 Calcium signaling pathway
    20191 (Ryr2)
   04024 cAMP signaling pathway
    20191 (Ryr2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    20191 (Ryr2)
   04921 Oxytocin signaling pathway
    20191 (Ryr2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    20191 (Ryr2)
   04261 Adrenergic signaling in cardiomyocytes
    20191 (Ryr2)
  09154 Digestive system
   04972 Pancreatic secretion
    20191 (Ryr2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    20191 (Ryr2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    20191 (Ryr2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    20191 (Ryr2)
   05414 Dilated cardiomyopathy (DCM)
    20191 (Ryr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    20191 (Ryr2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ryanodine receptor
   20191 (Ryr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_8 EF-hand_7 EF-hand_1 EF-hand_6
Motif
Other DBs
NCBI-GeneID: 20191
NCBI-ProteinID: NP_076357
MGI: 99685
Ensembl: ENSMUSG00000021313
UniProt: E9Q401 Q80ZZ5 Q60835
LinkDB All DBs
Structure
PDB: 

Position
13 A1; 13 4.38 cM
AA seq 4966 aa AA seqDB search
MADAGEGEDEIQFLRTDDEVVLQCTATIHKEQQKLCLAAEGFGNRLCFLESTSNSKNVPP
DLSICTFVLEQSLSVRALQEMLANTVEKSEGQVDVEKWKFMMKTAQGGGHRTLLYGHAIL
LRHSYSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGNSSWHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGAVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDKNLLLMDKEKADVKSTAFAFRSSKEKLDVGVRKEVDGMGTSEIKYGDSI
CYIQHVDTGLWLTYQAVDVKSARMGSIQRKAIMHHEGHMDDGLNLSRSQHEESRTARVIR
STVFLFNRFIRGLDALSKKVKLPTIDLPIESVSLSLQDLIGYFHPPDEHLEHEDKQNRLR
ALKNRQNLFQEEGMINLVLECIDRLHVYSSAAHFADVAGREAGESWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGYSPYPGGGEEWGGNGVGD
DLFSYGFDGLHLWSGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAACYEAVLPKEKLKVEHSREY
KQERTYTRDLLGPTVSLTQAAFTPVPVDTSQIVLPPHLERIRERLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFCKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEK
VKKMKLPKNYQLTSGYKPAPMDLSFIKLTPSQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYHLEAPDQDHASRAEVCSG
TGERFRIFRAEKTYAVKAGRWYFEFEAVTAGDMRVGWSRPGCQPDLELGSDDRAFAFDGF
KAQRWHQGNEHYGRSWQAGDVVGCMVDMNEHTMMFTLNGEILLDDSGSELAFKDFDVGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTIDSSPCLKVTQKSFGSQNNNTDIMFYRLSMPIECAEVFSKSVAG
GLPGAGFYGPKNDLEDFDVDSDFEVLMKTAHGHLVPDRIDKDKETPKPEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTGHSARLTEDVLADDRDDYEYLMQTSTYYYSVRIFPGQEPAN
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
NNSNGLEIGCVVDAASGLLTFIANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGR
IKNVMPLSAGLFKSEHKNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRISERQGWLV
QCLDPLQFMSLHIPEENRSVDILELTEQEELLQFHYHTLRLYSAVCALGNHRVAHALCSH
VDEPQLLYAIENKYMPGLLRAGYYDLLIDIHLSSYATARLMMNNEFIVPMTEETKSITLF
PDENKKHGLPGIGLSTSLRPRMRFSSPSFVSISNDCYQYSPEFPLDILKAKTIQMLTEAV
KEGSLHARDPVGGTTEFLFVPLIKLFYTLLIMGIFHNEDLKHILQLIEPSVFKEAAVPEE
EGGTPEKEISIEDAKLEGEEEAKGGKRPKEGLLQMKLPEPVKLQMCLLLQYLCDCQVRHR
IEAIVAFSDDFVAKLQDNQRFRYNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKD
DKSECPCPEEIRDQLLDFHEDLMTHCGIELDEDGSLDGSNDLTIRGRLLSLVEKVTYLKK
KQAEKPVASDSRKCSSLQQLISETMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLVRA
LPKTYTINGVSVEDTINLLASLGQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNL
MRALGMHETVMEVMVNVLGGGESKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYL
LENSSVGLASPAMRGSTPLDVAAASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLV
SKGYPDIGWNPVEGERYLDFLRFAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGN
GLLAAMEEAIKIAEDPSRDGPSPTSGSSKTLDIEEEEDDTIHMGNAIMTFYAALIDLLGR
CAPEMHLIHAGKGEAIRIRSILRSLIPLGDLVGVISIAFQMPTIAKDGKVVEPDMSAGFC
PDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLC
TAVLPLLTRCAPLFAGTEHHASLIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLR
PSMMQHLLRRLVFDVPLLNEHAKMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLS
RKLFWGIFDALSQKKYEQELFKLALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNF
NPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPLMKPYK
LLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVSIDAAHGY
SPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDTLTAKE
KAKDREKAQDIFKFLQISGYVVSRGFKDLDLDTPSIEKRFAYSFLQQLIRYVDEAHQYIL
EFDGGSRSKGEHFPYEQEIKFFAKVVLPLIDQYFKNHRLYFLSAASRPLCTGGHASNKEK
EMVTSLFCKLGVLVRHRISLFGNDATSIVNCLHILGQTLDARTVMKTGLDSVKSALRAFL
DNAAEDLEKTMENLKQGQFTHTRSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDL
ILEDVQVSCYRILTSLYALGTSKSIYVERQRSALGECLAAFAGAFPIAFLETHLDKHNVY
SIYNTRSSRERAALSLPANVEDVCPNIPSLEKLMTEIIELAESGIRYTQMPYMMEVVLPM
LCSYMSRWWEHGPENHPERAEMCCTALNSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAV
FSQPIINKVKPQLLKTHFLPLMEKLKKKAAMVVSEEDHLKAEARGDMSEAELLILDEFTT
LARDLYAFYPLLIRFVDYNRAKWLKEPNPEAEELFRMVAEVFIYWSKSHNFKREEQNFVV
QNEINNMSFLITDTKSKMSKAAISDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNIC
APGDQELIALAKNRFSLKDTEEEVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDP
SDPERTVERVLGIANVLFHLEQKSKYTGRGYFSLVEHPQRSKKAVWHKLLSKQRKRAVVA
CFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHYFEDKLIEDLAKPGAELPEEDEAMKRV
DPLHQLILLFSRTALTEKCKLEEDFLYMAYADIMAKSCHDEEDDDGEEEVKSFEEKEMEK
QKLLYQQARLHDRGAAEMVLQTISASKGETGPMVAATLKLGIAILNGGNSTVQQKMLDYL
KEKKDVGFFQSLAGLMQSCSVLDLNAFERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFR
FLQLLCEGHNSDFQNYLRTQTGNNTTVNIIISTVDYLLRVQESISDFYWYYSGKDIIDEQ
GQRNFSKAIQVAKQVFNTLTEYIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQD
SSQIELLKELMDLQKDMVVMLLSMLEGNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFL
KLKDLTSSDTFKEYDPDGKGVISKRDFHKAMESHKHYTQSETEFLLSCAETDENETLDYE
EFVKRFHEPAKDIGFNVAVLLTNLSEHMPNDTRLQTFLELAESVLNYFQPFLGRIEIMGS
AKRIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQ
LAAQISESDLNERLANKEESEKERPEEQAPRMGFFSLLTIQSALFALRYNVLTLVRMLSL
KSLKKQMKRMKKMTVKDMVLAFFSSYWSVFVTLLHFVASVCRGFFRIVSSLLLGGSLVEG
AKKIKVAELLANMPDPTQDEVRGDEEEGERKPLESALPSEDLTDLKELTEESDLLSDIFG
LDLKREGGQYKLIPHNPNAGLSDLMTNPVPVPEVQEKFQEQKAKEEKEEKEETKSEPEKA
EGEDGEKEEKAKDEKSKQKLRQLHTHRYGEPEVPESAFWKKIIAYQQKLLNYFARNFYNM
RMLALFVAFAINFILLFYKVSTSSVVEGKELPTRTSSDTAKVTNSLDSSPHRIIAVHYVL
EESSGYMEPTLRILAILHTIISFFCIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQP
SEDDIKGQWDRLVINTQSFPNNYWDKFVKRKVMDKYGEFYGRDRISELLGMDKAALDFSD
AREKKKPKKDSSLSAVLNSIDVKYQMWKLGVVFTDNSFLYLAWYMTMSVLGHYNNFFFAA
HLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDT
PDMKCDDMLTCYMFHMYVGVRAGGGIGDEIEDPAGDEYEIYRIIFDITFFFFVIVILLAI
IQGLIIDAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFF
LMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN
NT seq 14901 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcgggcgaaggcgaggatgagatccagttcctgagaactgatgatgaggtg
gttctgcagtgcacggcgaccatccacaaagaacagcagaagctgtgcttggcagcagaa
ggatttggcaacagactttgttttttggagtctacttccaattccaagaatgttcccccg
gacctgtctatctgcacctttgtgctggagcagtccctgtcagtacgggccctgcaggag
atgctggccaacacagtggaaaagtcagaagggcaggtggatgtggaaaagtggaagttc
atgatgaagactgctcaaggtggaggccaccggacactcctctatggacacgccatattg
ctacgccattcctacagtggtatgtatctttgctgtctctccacctcccggtcttccact
gacaaactggccttcgatgttggccttcaagaggataccacaggggaggcttgctggtgg
accatacatcctgcctctaagcagagatcagaaggagaaaaagtgcgtgttggagatgat
ctcatcttggtcagcgtgtcctcagaaaggtacttgcacttgtcatatggcaacagcagc
tggcatgtggatgctgccttccagcagaccctctggagcgtggcccctatcagctcagga
agtgaagcagcccaaggctatctcattggcggtgatgttctccggctgctgcatgggcac
atggatgaatgtctcactgtcccttcaggagagcatggtgaagaacagcggagaacagtt
cattatgaaggtggtgccgtatcagttcatgcccgctccctctggagactagagacccta
agagtcgcgtggagtggaagccacataagatggggccagccattccgactccggcatgtc
acgacaggaaaatacttaagcctcatggaagacaagaacctcctactcatggacaaagag
aaagcagatgtaaaatcaacagcgtttgccttccggtcttccaaggaaaaattggacgtg
ggggtgaggaaagaagtcgatggcatgggaacctcagaaatcaagtatggagactccatt
tgctacatacaacatgtggatacaggcctgtggctaacctaccaggctgtggatgtgaaa
tcagcacgaatgggatccatccagcgtaaggctatcatgcaccacgaaggccacatggac
gatggtttgaacttatccagatcacagcatgaggagtcccgcactgcccgcgtcattcgg
agcacagtgttcctctttaataggttcataaggggcctggatgctctcagcaagaaagta
aagctgcccaccattgacttgcccatcgagtctgtgagcctgagtttgcaggacctcatc
ggctacttccaccccccagatgagcacttggagcatgaggacaagcagaacaggctgcga
gccctgaagaacaggcagaatctcttccaggaagagggaatgatcaacctggttctggag
tgcatcgaccgcctgcatgtctacagcagtgcagcccactttgcagatgtcgcaggacga
gaagcaggagagtcttggaaatccatcctgaattctctgtatgagttgctggcggcccta
attagaggaaatcgtaaaaactgtgctcagttttctggttccctcgactggctgatcagc
agactggaaagactggaagcatcctcaggtatcctggaggtcctccactgtgtgttagtg
gagagcccagaagctctgaatatcatcaaagaagggcatatcaagtccattatctcgctt
ttagacaagcatgggagaaaccacaaggtcctggatgtgctgtgttctctctgtgtatgc
catggagttgctgtccgctctaatcagcacctcatctgtgataatctcctgccaggacga
gatctcttactgcagacccgtcttgtgaatcatgtcagcagcatgaggcctaatattttc
ctgggtgtcagcgaaggatcagcacagtataagaagtggtactacgagctcatggtggac
cacacggaaccctttgtgacggcagaagccactcacctgcgagtgggctgggcttccact
gaagggtattctccatacccaggtgggggtgaagagtggggtggcaatggcgttggtgac
gacctcttctcctatgggtttgatggccttcacctctggtcaggttgtatagctcggacc
gtgagctcccccaaccagcacctgctgagaactgacgatgtcatcagttgttgtttagat
ctaagtgcccccagcatctcgtttcgcattaatggacaaccggtgcaagggatgtttgag
aacttcaatatcgatggcctgttctttccagttgtcagtttctctgcaggaataaaggtt
cgctttttgcttggggggagacatggagaattcaagtttctccctccacctggctatgca
gcttgctatgaagctgtactacccaaagagaaattgaaggtggaacacagccgagaatat
aagcaggagaggacatacacacgagacctgctggggcctacagtgtccctgacccaagct
gccttcacacctgttcctgtggacaccagccagattgtgttgcctcctcacctggaaagg
ataagagaaagactggcagagaatatccatgagctctgggttatgaataaaattgagctt
ggctggcagtatggtccggttagagatgacaacaagagacagcacccatgtctggtggag
ttctgcaagcttccagaacaggaacgcaactataatttgcagatgtcgcttgaaaccctc
aagactttgctggcattgggatgtcacgtgggtatagctgatgaacatgctgaagagaag
gtgaagaaaatgaaactgcctaagaattaccagctgaccagcggatacaagcctgcccca
atggatctgagctttataaaactaaccccgtctcaggaagcaatggtggacaagttggct
gaaaatgctcacaatgtgtgggcccgggaccgaatccggcaaggctggacttacggcatc
cagcaggatgtaaagaatagaagaaaccctcgtctcgtcccctacactcttctggatgac
agaaccaagaagtccaacaaagacagtctccgagaggcagtgcgcacactgctgggctac
ggctaccacctggaagctcctgatcaggaccatgcctcgagagccgaggtgtgcagcggt
actggggagaggttccgcatcttcagggcagagaagacctatgcggtgaaggctgggcgc
tggtactttgaatttgaggctgtcactgctggagacatgcgggtgggctggagcaggcca
ggctgccaaccagatctagaactgggttctgatgaccgtgcctttgcttttgatggcttt
aaggcacagcggtggcaccagggcaatgaacactacgggcgctcatggcaagctggtgac
gtcgtgggctgcatggttgatatgaatgaacacaccatgatgttcactctgaacggcgag
atcctgctggatgattcaggctctgagctggcattcaaggactttgatgttggtgatgga
ttcatccctgtgtgtagcctcggggtggcacaagtaggcaggatgaactttggaaaggac
gtcagcactttgaaatattttaccatctgtggcttacaagaaggctatgagccatttgcc
gttaatacaaatagggacatcaccatgtggctgagcaagcggcttcctcagttcctccag
gtcccatcaaaccacgaacacattgaggtgaccagaatagatggtaccatagacagttct
ccatgtctgaaggtcactcagaagtcctttggttctcagaacaacaacactgacatcatg
ttttaccgcctgagtatgcccattgaatgtgccgaggtcttctcaaagtcggtggcggga
gggcttcctggtgccggcttctacgggcccaagaatgatttggaggactttgatgtggac
tctgactttgaggttctgatgaagacagctcatggtcatcttgtgcctgaccgcatcgac
aaggacaaagagacccctaagccagagttcaataaccacaaagattatgctcaggaaaag
ccctcacgactaaagcaaagattcttacttagaaggaccaagccagattacagcacaggc
cactctgcaagactcactgaagatgtccttgctgatgaccgggatgactacgagtacctg
atgcagacgtccacatactattactcggtgaggatctttcctggacaagaaccagctaat
gtctgggtgggctggattacatctgacttccaccagtacgacacaggctttgatttggac
agagtgcgcacagtgacggtcaccctaggagatgaaaaaggaaaagtgcatgagagcatc
aaacgcagcaactgctatatggtgtgtgcaggagagagcatgagccccgggcaaggacga
aacaacagcaacgggctggagattggctgtgtggtggatgctgccagtgggctgctcaca
ttcatagccaatggcaaggagctaagcacttactatcaggtggagccaagcacaaagctc
tttcctgcggttttcgcgcaagctacgagtcccaatgttttccagtttgagttgggcaga
ataaagaatgtaatgcctctctccgcgggactgtttaagagcgagcacaaaaaccccgtg
ccccagtgtcctccacgtctgcatgtgcagttcctgtcccatgtcctgtggagccggatg
cccaaccagttcttgaaggtggacgtctctcgaatcagtgaacgccaaggctggctggtg
cagtgtctagatcctctgcagttcatgtccctccatatacctgaggagaacagatctgtt
gacatcttagagctgacagagcaggaggagttgttgcagtttcactatcacaccctccgc
ctctactctgctgtctgcgcccttgggaatcatcgggtggctcacgccctgtgcagccac
gtggacgaacctcagctgctctacgccattgagaacaagtacatgcctggcttgctgcga
gctggctactatgacctgctgattgacatccacctcagctcctatgccaccgccaggctc
atgatgaacaacgaattcatcgtccctatgacagaggagacaaagagcatcaccctcttc
cctgatgagaataagaaacatggcctcccaggcataggccttagcacctccctccggcct
cggatgcgtttttcctccccgagtttcgtgagcattagcaacgactgttatcagtacagt
cccgagtttcctctggacatcctcaaggccaagaccatccagatgctcacagaagccgtg
aaggagggcagcctccacgctcgggatcctgtgggtgggaccacggagttcctctttgtg
cccctcatcaagctgttctacaccctgctcatcatgggcatctttcacaatgaggatttg
aaacacatcctgcagttgatcgagcccagtgtgtttaaggaagctgccgttccagaggag
gaaggaggcaccccggagaaggagatcagtatagaagacgccaagctggaaggcgaagaa
gaagccaaagggggtaaaaggcccaaggaaggcttgctccagatgaaactcccggagcca
gttaaactacagatgtgcctcttgcttcagtacctctgtgactgccaggttaggcaccgg
atcgaagccattgtagccttttcagatgactttgtagctaaactccaagacaaccaacgg
ttcaggtataatgaagtcatgcaagccttaaacatgtctgccgcactcactgccaggaaa
accagggagttccggtcaccaccgcaggagcagattaacatgcttctcaattttaaggat
gacaaaagtgaatgcccctgccctgaagaaatccgagaccaactcctagatttccacgag
gacctgatgactcactgtggaattgaactggacgaggatggatccctagatggaagcaat
gacttaacaatcagaggacgtctgttgtctctggtagaaaaggtgacctacctgaagaag
aagcaagctgaaaaaccagttgcaagtgactccagaaagtgctccagcctccagcaactc
atttctgagactatggtacggtgggctcaagagtctgtcattgaggaccctgagctggtg
agggccatgtttgtgctgctacatcggcagtatgatggcatcgggggtctagtccgagcg
ctgccaaagacctacactatcaacggggtctctgtggaggacaccatcaatctgcttgct
tcgctcggtcagatccgatctctgctgagtgtgaggatgggcaaagaagaggagaagctg
atgatccgtggactaggggatatcatgaataacaaagtgttttaccagcatcccaatctc
atgcgggcccttgggatgcatgagacagtgatggaagtcatggtgaatgtccttggaggt
ggcgagtccaaggaaatcaccttccccaagatggtggccaactgctgccgttttctctgt
tacttctgtcgtataagtagacagaatcaaaaagccatgtttgatcatctcagttactta
ctggaaaacagcagtgttggtcttgcatcaccagccatgagaggttcaactcctttagac
gtggccgcagcttcagtgatggataacaatgagcttgcccttgctctacgagagccggat
ctggagaaggtagttcgctatctggctggctgtggtctgcagagctgtcagatgctggtg
tctaagggttacccagacattgggtggaatccagttgaaggagagcgataccttgacttt
ctcagatttgcagtcttctgtaacggggagagtgtggaagagaatgcaaatgttgtggtg
aggctgctcatccggagacccgagtgctttggtcctgccttgagaggagaaggtggtaat
ggtctccttgcagccatggaagaagccataaaaatagctgaggatccttctagagatggt
ccctctccaaccagtggctccagcaaaacccttgatatagaagaggaggaagatgatacc
atccacatggggaacgcgatcatgaccttctacgcagctttgattgacctgcttggtcgc
tgtgctcctgaaatgcacttgattcatgctggaaagggagaagccatccgaattaggtcc
attttgcgatctctgattccattgggagacttggtgggcgtcatcagcattgcatttcag
atgccaacaatagccaaagatgggaaggtggtggagcctgacatgtccgcggggttttgc
ccagatcacaaggcagccatggttttgttccttgacagggtctatggaattgaggtgcaa
gatttcctcctccatctccttgaggttggctttctgccagatcttcgagctgctgcctct
ctagacacggctgcactaagtgctacagacatggccttggccctcaaccggtacctctgc
acagctgtcctacctttgttaacgaggtgtgctcccctgtttgctggaacagagcaccat
gcttccctcattgactctctgctacacactgtatatagactctctaagggatgctccctt
accaaagctcagcgggactccatagaagtgtgcctgctctctatatgtggccaactgaga
ccatctatgatgcaacacctactccgaaggctggtgtttgatgttccactgttgaatgag
catgcaaagatgcctctgaagctgctgaccaatcattatgaaagatgctggaaatattat
tgcctccctggagggtggggcaactttggtgctgcctcggaagaagaacttcatttatca
agaaaattattttggggcatctttgatgctttgtctcaaaagaaatatgaacaagaactt
ttcaaactggccctgccttgcctgagtgcagttgcgggagctttacctccagactacatg
gagtcaaactatgtcagtatgatggaaaaacagtcatccatggattctgaagggaacttt
aacccacaacctgttgatacctcaaacattacaattccagagaagttggaatacttcatt
aacaaatatgcagaacattcccatgataaatggtccatggacaagttggcgaatggatgg
atttatggggaaatatattcagactcttctaagatccaaccgctaatgaagccatataaa
ctcttgtctgaaaaggaaaaagaaatttatcgttggccaatcaaggagtctttgaaaacg
atgctggcttggggttggagaattgagagaacacgggagggggacagcatggccctttat
aaccggactcgacgaatttctcagacaagccaggtgtctatagatgctgcacatggatac
agcccccgtgctattgacatgagtaatgtgacactctctcgagacctgcatgctatggca
gagatgatggctgaaaactaccacaacatatgggccaagaaaaagaaactggagctggaa
tccaaaggaggaggaaaccaccccctcctggtgccttatgacacactgacagccaaggag
aaagccaaggacagagaaaaagcccaagacatcttcaagttcctacagatcagtggttat
gtggtatccagagggttcaaagacctggatctagatacaccttcgattgagaagcgattt
gcctatagtttcctgcagcagctgatccgatacgtggatgaggcgcatcagtacatcctg
gagtttgatggtggcagcagaagcaaaggagaacacttcccgtacgagcaagaaatcaag
ttctttgccaaagttgttcttcctttaattgatcagtatttcaaaaaccaccgcctgtac
ttcttgtctgctgcaagcaggcctctctgcactggaggacatgcatccaacaaagagaag
gagatggtgacaagcctgttctgcaaacttggagttcttgtcaggcataggatctcactg
tttgggaatgatgccacctcaattgtgaactgtctgcacattttgggtcagactttggat
gcaaggactgtgatgaagacgggcctagacagtgtgaaaagtgctcttagggcctttctg
gacaatgctgcagaggatttggaaaagacaatggaaaacctgaagcagggccagtttact
cacaccaggagccagcccaagggggtgactcagatcatcaactacaccactgtggctctc
ctgcccatgctctcctccctgtttgaacacatcggccagcatcagtttggagaagatctg
atattggaggatgtacaggtgtcttgttatagaatcctgaccagcttgtatgccctggga
accagcaagagcatctacgtggagaggcaacgatctgcacttggggaatgcttagctgcc
tttgctggtgccttccctatcgcctttttggaaacccacctggacaaacataacgtttac
tccatctacaacaccagatcttcacgagaaagagcagctctcagtttacctgcaaatgtg
gaggatgtctgcccaaatataccatccctggagaagcttatgactgagataatagagctg
gcagagtcaggaatccgctacactcagatgccatacatgatggaggttgtactgcccatg
ttatgcagctacatgtcaaggtggtgggaacacggtcctgagaaccatccagagagggct
gagatgtgctgcacagccctcaactcagagcacatgaacacgctgctgggcaacattctc
aaaatcatctacaacaacctggggattgatgaaggagcctggatgaagcgcttggccgtg
ttttcacagcctatcatcaacaaagtgaaacctcagctcttgaaaactcatttcttaccc
ttgatggagaagctaaagaaaaaggctgctatggtagtgtctgaggaagaccacctgaaa
gccgaagccagaggggacatgtctgaggccgagctgctcattctagatgagttcaccaca
ctggccagggatctctatgccttctacccactcctgatccgatttgtggactataacagg
gcaaagtggctgaaggagcccaacccagaagcagaggagctatttcgaatggtggctgaa
gtcttcatctactggtccaaatcccataatttcaaaagagaagaacagaactttgtggtg
cagaatgaaatcaacaacatgtccttcctcatcactgacacaaagtccaagatgtccaag
gcagccatttctgatcaagaaaggaagaaaatgaagcgcaaaggggaccggtattctatg
cagacatctttgatcgtggcagctctgaagagattactacccattgggctgaacatctgt
gcccctggtgaccaagagctcattgctttggccaaaaatagatttagcttgaaagacacc
gaggaggaagtacgtgatataatccgcagtaatatacacttacaaggcaagctggaagac
cctgcaatcaggtggcagatggctctctacaaagacttgccaaacaggacagaagacccc
tcagacccagagaggacagtcgagcgtgtcctgggtatagcaaatgtgctttttcacctt
gagcagaaatctaagtatactggccggggatatttcagcctggtggaacatcctcaaaga
tcaaagaaagctgtgtggcacaaactactctctaagcagagaaaaagagctgttgtggcc
tgcttccggatggcccccttgtacaatctgccaaggcatcgggcggtcaatctttttctt
cagggatatgaaaagtcttggattgaaacagaagaacattactttgaggataaattgatt
gaagatttagcgaaaccaggggctgagctcccagaagaagatgaagccatgaaaagggtt
gatcccctccatcaacttattcttctgttcagccgcacagccctaacggagaaatgcaaa
ctggaggaagattttctatacatggcgtatgcagacattatggcaaagagttgtcacgat
gaagaagatgatgatggtgaagaagaagtgaagagctttgaagaaaaggaaatggaaaag
cagaaacttctgtaccagcaagccagactgcatgaccgcggggcagcagagatggtcctg
cagactatcagtgccagcaaaggtgaaactggaccaatggtggctgctactttgaagctg
ggcattgcgattttaaatggtggcaactccacggtgcagcagaagatgctggattacctg
aaggaaaaaaaggatgtaggcttcttccagagtctggcaggcctcatgcagtcctgcagt
gtcctggacctgaatgcatttgagagacaaaacaaagcagaaggacttgggatggtgact
gaggaaggatcaggggagaaggttctgcaggatgacgagttcacctgtgacctcttccga
ttcctgcagctgctttgtgaggggcacaactcagactttcagaattacctgagaactcag
accggcaacaacaccacagttaatatcatcatctctactgtggactacctccttcgagtg
caggagtccattagtgatttctattggtactactctggcaaggacatcatagatgagcag
gggcagcgtaacttttccaaagccattcaagtggcgaagcaggtgttcaacacgctcacg
gagtacatccagggcccttgtactggaaatcagcagagcctggcacacagcaggctgtgg
gatgctgttgtgggcttccttcatgtatttgcacacatgcaaatgaagctgtctcaggat
tccagccagattgagctcttaaaagaacttatggatctccagaaggacatggtggtcatg
ctgctgtctatgctagaaggtaatgtggtgaacggaacaataggcaaacagatggtggac
atgcttgtggagtcgtccaacaacgtggagatgatcctcaagttctttgacatgtttctg
aagctgaaggacttaacatcctctgacacattcaaagagtatgaccctgatggcaaaggg
gtcatttccaagagagacttccacaaagccatggagagccacaagcactacacccagtca
gagactgagttcctgctgtcctgtgcagagacagatgaaaacgagacacttgactatgaa
gagtttgtcaagaggttccatgagcctgccaaggacatcggcttcaacgtggctgttctg
ctgaccaacctctcagagcacatgcccaatgacacgaggctgcagaccttcttggagttg
gcagagagtgtcctcaactacttccaacctttcctgggtcgcattgagatcatgggcagt
gccaagcgcatcgaaagggtctattttgagatcagcgaatccagccgaacccagtgggag
aaaccccaggttaaggagtccaagaggcagttcatattcgatgtggtcaatgagggcggg
gagaaggagaagatggagctctttgtgaacttctgtgaggacaccatctttgagatgcag
ttggcagctcagatctcagagtctgatctgaatgagaggttggctaataaagaagagagt
gagaaggagaggccagaggagcaggccccacgaatgggcttcttctccctcctcaccatc
cagtcagccctgtttgctctcaggtacaatgtcctaaccctcgtgaggatgctcagcctg
aagagcctgaagaagcagatgaagaggatgaagaagatgacagtgaaggacatggtcttg
gccttcttctcatcctactggagtgtgtttgtcaccctcttgcacttcgtggccagtgtc
tgcaggggcttctttcgcattgtctccagcctgttgctggggggcagcctggtggaaggt
gctaagaaaatcaaagtggcagaacttctagctaacatgccagaccccactcaggatgag
gtgcgaggagatgaggaggagggagagaggaagcctttagagtcagccctgccctctgaa
gacctgacagacttgaaggaactgacagaggagagtgatcttctttctgacatattcggc
ttggatctgaagagagaaggagggcagtacaaactaattcctcacaacccaaatgccggc
ctcagtgacctcatgaccaaccctgtccctgtccctgaggtacaagaaaagtttcaggag
cagaaggcgaaagaggaaaaggaagaaaaggaagaaaccaagtcggaaccagagaaagct
gaaggggaggatggagaaaaagaagaaaaagccaaagatgagaagagcaaacagaagttg
aggcagcttcatacacatcgctatggggagccggaagtgcctgagtcagcattctggaag
aaaatcatagcctaccaacagaagctgctgaactattttgctcgcaacttttacaacatg
agaatgctggccttgtttgttgccttcgccatcaatttcatcctgctcttctacaaggtc
tccacttcttctgtggttgaaggaaaggagctgcctacccgaacctccagcgatactgct
aaagtgaccaacagcctagacagcagcccccacaggatcattgcggttcactatgtcctg
gaggagagcagcggctacatggaacccaccctgcgcatcttagccatcctccacaccatc
atctccttcttttgcatcatcggatactactgcttgaaagtccccttggttatttttaag
cgagagaaggaagtggcacggaagttggagtttgacggactttatataacagagcagcca
tcggaagatgatatcaaaggccagtgggacagacttgtgatcaacacacagtcatttccc
aataactactgggataaatttgtgaaaagaaaggtaatggataaatatggagagttttat
gggagagacagaatcagtgagttactgggcatggataaggctgcactagatttcagcgat
gcaagagagaagaagaagcccaagaaagacagctccttgtctgctgtattgaattctatt
gacgtgaagtaccagatgtggaaacttggagtcgtgttcacagacaattccttcctctac
ctagcctggtacatgaccatgtctgttcttggacattataacaactttttttttgctgct
cacctccttgacatcgcgatgggattcaagaccttgagaactatcctgtcctcagttacc
cataatggcaaacagctcgtgttaactgttggcttattggctgttgttgtgtacctgtac
actgtcgtggcgttcaatttcttccgaaaattctacaataaaagtgaggatggtgacacg
ccagacatgaagtgtgatgacatgctgacgtgttacatgttccacatgtatgtgggcgtc
cgtgctggagggggcattggtgatgaaattgaagacccagcaggagacgagtatgagatc
taccgcatcatctttgacatcacattcttcttcttcgtgattgtcatccttttggctatc
atacaaggtttgatcattgatgcttttggagaactcagagaccaacaagagcaagtcaag
gaagacatggagaccaagtgcttcatctgtgggattggcaacgattattttgatacagtg
ccacatggctttgaaacccatactttacaggaacacaacctggccaactacctgtttttt
ctgatgtatctcataaacaaggatgaaacagaacacacaggacaggaatcttacgtctgg
aagatgtaccaagagaggtgttgggaatttttcccagcaggggactgtttccggaaacag
tatgaagaccagttaaattag

DBGET integrated database retrieval system