KEGG   Mus musculus (mouse): 20303Help
Entry
20303             CDS       T01002                                 

Gene name
Ccl4, AT744.1, Act-2, MIP-1B, Mip1b, Scya4
Definition
(RefSeq) chemokine (C-C motif) ligand 4
  KO
K12964  C-C motif chemokine 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu05132  Salmonella infection
mmu05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20303 (Ccl4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20303 (Ccl4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20303 (Ccl4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20303 (Ccl4)
   04623 Cytosolic DNA-sensing pathway
    20303 (Ccl4)
   04062 Chemokine signaling pathway
    20303 (Ccl4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    20303 (Ccl4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    20303 (Ccl4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20303 (Ccl4)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20303 (Ccl4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 20303
NCBI-ProteinID: NP_038680
MGI: 98261
Ensembl: ENSMUSG00000018930
Vega: OTTMUSG00000000993
UniProt: P14097 Q5QNV9
LinkDB All DBs
Position
11 C; 11 51.09 cM
AA seq 92 aa AA seqDB search
MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSK
PAVVFLTKRGRQICANPSEPWVTEYMSDLELN
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctgcgtgtctgccctctctctcctcttgctcgtggctgccttctgtgctcca
gggttctcagcaccaatgggctctgaccctcccacttcctgctgtttctcttacacctcc
cggcagcttcacagaagctttgtgatggattactatgagaccagcagtctttgctccaag
ccagctgtggtattcctgaccaaaagaggcagacagatctgtgctaaccccagtgagccc
tgggtcactgagtacatgagtgacttggagttgaactga

DBGET integrated database retrieval system