KEGG   Mus musculus (mouse): 20315Help
Entry
20315             CDS       T01002                                 

Gene name
Cxcl12, Pbsf, Scyb12, Sdf1, Tlsf, Tpar1
Definition
(RefSeq) chemokine (C-X-C motif) ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04360  Axon guidance
mmu04670  Leukocyte transendothelial migration
mmu04672  Intestinal immune network for IgA production
mmu04810  Regulation of actin cytoskeleton
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    20315 (Cxcl12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    20315 (Cxcl12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    20315 (Cxcl12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    20315 (Cxcl12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    20315 (Cxcl12)
   04672 Intestinal immune network for IgA production
    20315 (Cxcl12)
   04062 Chemokine signaling pathway
    20315 (Cxcl12)
  09158 Development
   04360 Axon guidance
    20315 (Cxcl12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20315 (Cxcl12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    20315 (Cxcl12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    20315 (Cxcl12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    20315 (Cxcl12)
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20315 (Cxcl12)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Chemokines
   20315 (Cxcl12)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Chemokines
   20315 (Cxcl12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 20315
NCBI-ProteinID: NP_038683
MGI: 103556
Ensembl: ENSMUSG00000061353
Vega: OTTMUSG00000022768
UniProt: P40224
LinkDB All DBs
Structure
PDB: 

Position
6 54.81 cM; 6 F1
AA seq 93 aa AA seqDB search
MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIV
ARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggacgccaaggtcgtcgccgtgctggccctggtgctggccgcgctctgcatcagtgac
ggtaaaccagtcagcctgagctaccgatgcccctgccggttcttcgagagccacatcgcc
agagccaacgtcaagcatctgaaaatcctcaacactccaaactgtgcccttcagattgtt
gcacggctgaagaacaacaacagacaagtgtgcattgacccgaaattaaagtggatccaa
gagtacctggagaaagctttaaacaagaggctcaagatgtga

DBGET integrated database retrieval system