KEGG   Mus musculus (mouse): 20375Help
Entry
20375             CDS       T01002                                 

Gene name
Spi1, Dis-1, Dis1, PU.1, Sfpi-1, Sfpi1, Spi-1, Tcfpu1, Tfpu.1
Definition
(RefSeq) spleen focus forming virus (SFFV) proviral integration oncogene
  KO
K09438  transcription factor PU.1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    20375 (Spi1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20375 (Spi1)
   05202 Transcriptional misregulation in cancer
    20375 (Spi1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    20375 (Spi1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    20375 (Spi1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20375 (Spi1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    20375 (Spi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 20375
NCBI-ProteinID: NP_035485
MGI: 98282
Ensembl: ENSMUSG00000002111
Vega: OTTMUSG00000014371
UniProt: P17433 Q3U5L4
LinkDB All DBs
Structure
PDB: 

Position
2 E1; 2 50.44 cM
AA seq 272 aa AA seqDB search
MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHYWDFSAHHVHN
NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSHQVSYMPRMCF
PYQTLSPAHQQSSDEEEGERQSPPLEVSDGEADGLEPGPGLLHGETGSKKKIRLYQFLLD
LLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKT
GEVKKVKKKLTYQFSGEVLGRGGLAERRLPPH
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggcgtgcaaaatggaagggttttccctcaccgcccctccatcggatgacttg
gttacttacgattcagagctataccaacgtccaatgcatgactactactccttcgtgggc
agcgatggagaaagccatagcgatcactactgggatttctccgcacaccatgtccacaac
aacgagtttgagaacttccctgagaaccacttcacagagctgcagagtgtgcagcccccg
cagctacagcagctctatcgccacatggagctggaacagatgcacgtcctcgatactccc
atggtgccaccccacaccggcctcagtcaccaggtttcctacatgccccggatgtgcttc
ccttatcaaaccttgtccccagcccaccagcagagctcagatgaggaggagggtgagagg
cagagccctcccctggaggtgtctgatggagaagctgatggcttggagcctgggccaggt
cttctgcacggggagacaggcagcaagaaaaagattcgcctgtaccagttcctgctggac
ctgctgcgcagcggcgacatgaaggacagcatctggtgggtggacaaggacaaaggtacc
ttccagttctcgtccaagcacaaggaggcgctggcgcaccgctggggcatccagaagggc
aaccgcaagaagatgacctaccagaagatggcgcgcgcgctgcgcaactacggcaagaca
ggcgaggtgaagaaagtcaagaagaagctcacctaccagttcagcggcgaggtgctgggc
cgtgggggcctggccgagcggcgcctcccgccccactga

DBGET integrated database retrieval system