KEGG   Mus musculus (mouse): 20423Help
Entry
20423             CDS       T01002                                 

Gene name
Shh, 9530036O11Rik, Dsh, Hhg1, Hx, Hxl3, M100081, ShhNC
Definition
(RefSeq) sonic hedgehog
  KO
K11988  sonic hedgehog
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu04360  Axon guidance
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    20423 (Shh)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    20423 (Shh)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20423 (Shh)
   05205 Proteoglycans in cancer
    20423 (Shh)
  09162 Cancer: specific types
   05226 Gastric cancer
    20423 (Shh)
   05217 Basal cell carcinoma
    20423 (Shh)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    20423 (Shh)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    20423 (Shh)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C46: hedgehog family
   20423 (Shh)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Morphogens
   20423 (Shh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Motif
Other DBs
NCBI-GeneID: 20423
NCBI-ProteinID: NP_033196
MGI: 98297
Ensembl: ENSMUSG00000002633
Vega: OTTMUSG00000021299
UniProt: Q62226
LinkDB All DBs
Structure
PDB: 

Position
5 B1; 5 14.39 cM
AA seq 437 aa AA seqDB search
MLLLLARCFLVILASSLLVCPGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGAS
GRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPG
VKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKA
HIHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKLVKDLRPGDRVLAADDQGRLLYSDFL
TFLDRDEGAKKVFYVIETLEPRERLLLTAAHLLFVAPHNDSGPTPGPSALFASRVRPGQR
VYVVAERGGDRRLLPAAVHSVTLREEEAGAYAPLTAHGTILINRVLASCYAVIEEHSWAH
RAFAPFRLAHALLAALAPARTDGGGGGSIPAAQSATEARGAEPTAGIHWYSQLLYHIGTW
LLDSETMHPLGMAVKSS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctggccagatgttttctggtgatccttgcttcctcgctgctggtgtgc
cccgggctggcctgtgggcccggcagggggtttggaaagaggcggcaccccaaaaagctg
acccctttagcctacaagcagtttattcccaacgtagccgagaagaccctaggggccagc
ggcagatatgaagggaagatcacaagaaactccgaacgatttaaggaactcacccccaat
tacaaccccgacatcatatttaaggatgaggaaaacacgggagcagaccggctgatgact
cagaggtgcaaagacaagttaaatgccttggccatctctgtgatgaaccagtggcctgga
gtgaagctgcgagtgaccgagggctgggatgaggacggccatcattcagaggagtctcta
cactatgagggtcgagcagtggacatcaccacgtccgaccgggaccgcagcaagtacggc
atgctggctcgcctggctgtggaagcaggtttcgactgggtctactatgaatccaaagct
cacatccactgttctgtgaaagcagagaactccgtggcggccaaatccggcggctgtttc
ccgggatccgccaccgtgcacctggagcagggcggcaccaagctggtgaaggacttacgt
cccggagaccgcgtgctggcggctgacgaccagggccggctgctgtacagcgacttcctc
accttcctggaccgcgacgaaggcgccaagaaggtcttctacgtgatcgagacgctggag
ccgcgcgagcgcctgctgctcaccgccgcgcacctgctcttcgtggcgccgcacaacgac
tcggggcccacgcccgggccaagcgcgctctttgccagccgcgtgcgccccgggcagcgc
gtgtacgtggtggctgaacgcggcggggaccgccggctgctgcccgccgcggtgcacagc
gtgacgctgcgagaggaggaggcgggcgcgtacgcgccgctcacggcgcacggcaccatt
ctcatcaaccgggtgctcgcctcgtgctacgctgtcatcgaggagcacagctgggcacac
cgggccttcgcgcctttccgcctggcgcacgcgctgctggccgcgctggcacccgcccgc
acggacggcgggggcgggggcagcatccctgcagcgcaatctgcaacggaagcgaggggc
gcggagccgactgcgggcatccactggtactcgcagctgctctaccacattggcacctgg
ctgttggacagcgagaccatgcatcccttgggaatggcggtcaagtccagctga

DBGET integrated database retrieval system