KEGG   Mus musculus (mouse): 20482Help
Entry
20482             CDS       T01002                                 

Gene name
Skil, Skir, SnoN, sno
Definition
(RefSeq) SKI-like
  KO
K18499  Ski-like protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    20482 (Skil)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ski_Sno c-SKI_SMAD_bind DUF489
Motif
Other DBs
NCBI-GeneID: 20482
NCBI-ProteinID: NP_035516
MGI: 106203
Ensembl: ENSMUSG00000027660
Vega: OTTMUSG00000027813
UniProt: Q60665 Q3TB81
LinkDB All DBs
Position
3 A3; 3 15.12 cM
AA seq 675 aa AA seqDB search
MENLQSKFSLVQGSNKKLNGMEDDGSPPVKKMMTDIHANGKTLTKVKKEHLDDYGDASVE
PDGEHAKRNRVSLPETLNLNPSLKHTLAQFHLSSQSSLGGPAAFSARYSQESMSPTVFLP
LPSPQVLPGPLLIPSDSSTELTQTLLEGESISCFQVGGEKRLCLPQVLNSVLREFSLQQI
NTVCDELYIYCSRCTSDQLHILKVLGILPFNAPSCGLITLTDAQRLCNALLRPRTFPQNG
SILPAKSSLAQLKETGSAFEVEHECLGKCQGLFAPQFYVQPDAPCIQCLECCGMFAPQTF
VMHSHRSPDKRTCHWGFESAKWHCYLHVNQKYLGTPEEKKLKIILEEMKEKFSMRNGKRI
QSKTDTPSGMELPSWYPVIKQEGDHVPQTHSFLHPSYYLYMCDKVVAPNVSLTSAASQSK
EATKAETSKSTSKQSEKPHESSQHQKTVSYPDVSLEEQEKMDLKTSRELYSCLDSSISNN
STSRKKSESAVCSLVRGTSKRDSEDSSPLLVRDGEDDKGKIMEDVMRTYVRQQEKLNSIL
QRKQQLQMEVEMLSSSKAMKELTEEQQNLQKELESLQSEHAQRMEEFYIEQRDLEKKLEQ
VMQQKCTCDSTLEKDREAEYAAQLAELRQRLDHAEADRQELQDELRQEREARQKLEMMIK
ELKLQIGKSSKPSKD
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacctccagtctaagttctccttagttcagggttcaaataaaaagctgaacggc
atggaggatgatggcagtcctcctgtgaaaaaaatgatgaccgacattcatgccaatggg
aaaaccctgaccaaggtgaagaaggagcacttagatgactatggagatgcatccgtggag
ccggatggcgagcacgccaagcgaaaccgtgtttctctacctgaaactttaaatttaaac
cccagtctgaaacacacgctggcacaattccacttaagcagtcagagctctttgggtgga
ccagcagcattttctgctcgatattcccaggagagcatgtcaccgactgtattcctgcct
cttccctctcctcaggttcttcccggccctcttctcattccttctgatagctccacagag
ctcactcagactcttttggaaggggagtctatttcttgttttcaagttggaggagaaaag
agactctgtttgccccaagtcttaaactctgtcctccgagaattttcactccagcagata
aacacagtatgtgatgagctgtacatctattgttcaaggtgtacttcagaccagcttcat
atcttaaaggtcttagggatactcccatttaatgctccatcctgtgggctgatcacgttg
accgatgcacaaagactctgtaatgctttactgcggccacgaacttttcctcaaaatggt
agcatacttcctgctaaaagctctctggcccagttgaaggaaactggcagtgcctttgaa
gtggaacatgaatgcttgggcaaatgtcagggtctctttgcgcctcagttttatgttcag
cccgacgctccctgtatccagtgcctggagtgctgtggaatgtttgctccccagacgttc
gtcatgcattcgcacagatcccctgacaagagaacttgccattggggctttgagtcagcc
aagtggcactgttaccttcatgtgaaccaaaaatacctagggacacccgaagaaaagaaa
ctgaagataattttagaagaaatgaaggagaagtttagcatgagaaatggaaagagaatc
caatcaaagacagatacaccatcgggaatggaattgccatcatggtatcctgttataaaa
caggaaggtgaccatgttccccagacacattcatttttacaccccagctactacctgtac
atgtgtgacaaagtggttgcaccgaatgtgtcgctcacatctgctgcgtcccagtctaaa
gaggccaccaaggcagagacaagtaagtccacctccaaacagtcagaaaagcctcatgag
agtagtcagcatcaaaaaacagtgtcttacccagacgtctcacttgaggagcaggagaaa
atggatttaaaaaccagtagagaattatacagttgtttagattcatcaatctcaaataat
tctacaagtagaaagaaatctgagtctgctgtgtgcagcttagtgagaggcacaagcaag
cgtgattcagaagattcctctccacttctggtcagagatggtgaagacgacaaggggaag
atcatggaagacgtgatgagaacctatgtaagacagcaggagaagctgaactccattctg
cagaggaagcagcagctgcagatggaggtggagatgctgagcagttcaaaggcgatgaag
gagctcactgaagagcagcagaatctacagaaagagcttgagtcgttacagagtgagcat
gctcagaggatggaggaattctatattgaacagagagacttagagaaaaagctggagcag
gtgatgcagcagaaatgcacctgtgactcaaccttggagaaggacagggaggccgagtat
gcggctcagctggcagaactgaggcaaagactagaccatgctgaggccgacaggcaggaa
ctccaagatgaactcagacaggagcgggaggcgagacagaagctggagatgatgataaag
gagctgaagctgcagattggcaagtcgtccaagccctccaaggactaa

DBGET integrated database retrieval system