KEGG   Mus musculus (mouse): 20655Help
Entry
20655             CDS       T01002                                 

Gene name
Sod1, B430204E11Rik, Cu/Zn-SOD, CuZnSOD, Ipo-1, Ipo1, SODC, Sod-1
Definition
(RefSeq) superoxide dismutase 1, soluble
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
mmu04213  Longevity regulating pathway - multiple species
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05016  Huntington disease
mmu05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    20655 (Sod1)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    20655 (Sod1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    20655 (Sod1)
   05016 Huntington disease
    20655 (Sod1)
   05020 Prion diseases
    20655 (Sod1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     20655 (Sod1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 20655
NCBI-ProteinID: NP_035564
MGI: 98351
Ensembl: ENSMUSG00000022982
UniProt: P08228
LinkDB All DBs
Structure
PDB: 

Position
16 C3.3; 16 51.56 cM
AA seq 154 aa AA seqDB search
MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTS
AGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVV
HEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaaagcggtgtgcgtgctgaagggcgacggtccggtgcagggaaccatccac
ttcgagcagaaggcaagcggtgaaccagttgtgttgtcaggacaaattacaggattaact
gaaggccagcatgggttccacgtccatcagtatggggacaatacacaaggctgtaccagt
gcaggacctcattttaatcctcactctaagaaacatggtggcccggcggatgaagagagg
catgttggagacctgggcaatgtgactgctggaaaggacggtgtggccaatgtgtccatt
gaagatcgtgtgatctcactctcaggagagcattccatcattggccgtacaatggtggtc
catgagaaacaagatgacttgggcaaaggtggaaatgaagaaagtacaaagactggaaat
gctgggagccgcttggcctgtggagtgattgggattgcgcagtaa

DBGET integrated database retrieval system