KEGG   Mus musculus (mouse): 20674Help
Entry
20674             CDS       T01002                                 

Gene name
Sox2, Sox-2, lcc, ysb
Definition
(RefSeq) SRY (sex determining region Y)-box 2
  KO
K16796  transcription factor SOX2 (SOX group B)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    20674 (Sox2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    20674 (Sox2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20674 (Sox2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG SOX
    20674 (Sox2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SOXp HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 20674
NCBI-ProteinID: NP_035573
MGI: 98364
Ensembl: ENSMUSG00000074637
Vega: OTTMUSG00000021249
UniProt: P48432 Q60I23
LinkDB All DBs
Structure
PDB: 

Position
3 A3; 3 16.93 cM
AA seq 319 aa AA seqDB search
MYNMMETELKPPGPQQASGGGGGGGNATAAATGGNQKNSPDRVKRPMNAFMVWSRGQRRK
MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT
LMKKDKYTLPGGLLAPGGNSMASGVGVGAGLGAGVNQRMDSYAHMNGWSNGSYSMMQEQL
GYPQHPGLNAHGAAQMQPMHRYDVSALQYNSMTSSQTYMNGSPTYSMSYSQQGTPGMALG
SMGSVVKSEASSSPPVVTSSSHSRAPCQAGDLRDMISMYLPGAEVPEPAAPSRLHMAQHY
QSGPVPGTAINGTLPLSHM
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgtataacatgatggagacggagctgaagccgccgggcccgcagcaagcttcggggggc
ggcggcggaggaggcaacgccacggcggcggcgaccggcggcaaccagaagaacagcccg
gaccgcgtcaagaggcccatgaacgccttcatggtatggtcccgggggcagcggcgtaag
atggcccaggagaaccccaagatgcacaactcggagatcagcaagcgcctgggcgcggag
tggaaacttttgtccgagaccgagaagcggccgttcatcgacgaggccaagcggctgcgc
gctctgcacatgaaggagcacccggattataaataccggccgcggcggaaaaccaagacg
ctcatgaagaaggataagtacacgcttcccggaggcttgctggcccccggcgggaacagc
atggcgagcggggttggggtgggcgccggcctgggtgcgggcgtgaaccagcgcatggac
agctacgcgcacatgaacggctggagcaacggcagctacagcatgatgcaggagcagctg
ggctacccgcagcacccgggcctcaacgctcacggcgcggcacagatgcaaccgatgcac
cgctacgacgtcagcgccctgcagtacaactccatgaccagctcgcagacctacatgaac
ggctcgcccacctacagcatgtcctactcgcagcagggcacccccggtatggcgctgggc
tccatgggctctgtggtcaagtccgaggccagctccagcccccccgtggttacctcttcc
tcccactccagggcgccctgccaggccggggacctccgggacatgatcagcatgtacctc
cccggcgccgaggtgccggagcccgctgcgcccagtagactgcacatggcccagcactac
cagagcggcccggtgcccggcacggccattaacggcacactgcccctgtcgcacatgtga

DBGET integrated database retrieval system