KEGG   Mus musculus (mouse): 20683
Entry
20683             CDS       T01002                                 

Gene name
Sp1, 1110003E12Rik, AA450830, AI845540, Sp1-1
Definition
(RefSeq) trans-acting transcription factor 1
  KO
K04684  transcription factor Sp1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04137  Mitophagy - animal
mmu04350  TGF-beta signaling pathway
mmu04915  Estrogen signaling pathway
mmu04927  Cortisol synthesis and secretion
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04934  Cushing syndrome
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05224  Breast cancer
mmu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    20683 (Sp1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    20683 (Sp1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    20683 (Sp1)
   04928 Parathyroid hormone synthesis, secretion and action
    20683 (Sp1)
   04927 Cortisol synthesis and secretion
    20683 (Sp1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20683 (Sp1)
   05202 Transcriptional misregulation in cancer
    20683 (Sp1)
   05231 Choline metabolism in cancer
    20683 (Sp1)
  09162 Cancer: specific types
   05224 Breast cancer
    20683 (Sp1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    20683 (Sp1)
   05017 Spinocerebellar ataxia
    20683 (Sp1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    20683 (Sp1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    20683 (Sp1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    20683 (Sp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20683 (Sp1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    20683 (Sp1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    20683 (Sp1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    20683 (Sp1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 20683
NCBI-ProteinID: NP_038700
MGI: 98372
Ensembl: ENSMUSG00000001280
Vega: OTTMUSG00000035159
UniProt: O89090 G3X8Q0
LinkDB
Position
15; 15 F3
AA seq 781 aa
MSDQDHSMDEVTAVVKIEKDVGGNNGGSGNGGGAAFSQTRSSSTGSSSSSGGGGGQESQP
SPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTAAQLSQGANGWQIISSSSGATP
TSKEQSGNSTNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQFQT
VDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIIPNRGSGGNIIAAMPNLLQQAVPLQGL
ANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAGTISSSGSQESSSQPVTS
GTAISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTSSGSSGTSSQGQTPQRVGG
LQGSDSLNIQQNQTSGGSLQGSQQKEGEQSQQTQQQQILIQPQLVQGGQALQALQAAPLS
GQTFTTQAISQETLQNLQLQAVQNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQT
ITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSG
IQVHQLPGLPLAIANTPGDHGTQLGLHGSGGDGIHDETAGGEGENSSDLQPQAGRRTRRE
ACTCPYCKDSEGRASGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCNWSY
CGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVG
TLPLDSGAGSEGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVTELQSINISGNG
F
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaagtgacagctgtggtgaagattgaaaaagat
gttggtggcaataatgggggtagcggcaatggtggcggtgccgccttttctcagactcga
agcagcagcacaggcagtagcagcagcagtggtggcggaggagggcaggaatcccagcca
tctcctttggctctgctggcagcaacctgcagcagaattgagtcacccaatgagaacagc
aacaactcccagggtccgagtcagtcagggggcacaggtgaacttgacctcacagccgca
caactttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccct
acctcaaaggaacagagtggcaacagtaccaatggcagcgagtcttccaagaaccgcaca
gtctctggtgggcagtatgttgtggctgctacccccaacttacagaaccagcaagttctg
acaggtctccctggagtaatgcctaatattcagtatcaagtaatcccacagttccagact
gttgatgggcagcagctgcagtttgctgccactggggcccaagtgcagcaggatggttct
ggtcaaatacagatcataccaggtgcaaaccaacagatcatcccaaatagaggaagtggg
ggcaacattattgctgctatgccaaatctactccagcaggctgtcccccttcaaggcctt
gctaataatgtgctctcaggacagactcagtatgtgaccaatgtaccagtggccctgaat
gggaacatcaccttgctacctgtcaacagcgtttctgcagctaccctgactcccagctct
caggcaggcactatcagcagctctggatcccaggagagcagctcacagcctgtcacctca
gggactgccatcagttctgccagcttggtgtcatcacaagctagttccagctcctttttt
accaatgccaatagttattcaacaactactaccaccagcaacatgggaattatgaacttt
accagcagtggctcatcagggactagttctcaaggccagacgccccagagggttggtggg
ctacaagggtctgattctctgaacatccagcagaaccagacatcaggaggctcgctgcaa
ggaagtcagcagaaagagggagagcaaagtcagcagacacagcaacaacaaatccttatt
cagcctcagctagttcaaggaggacaagctcttcaggcccttcaagcagcaccattgtcc
ggacagaccttcacaactcaagctatttcccaggaaacccttcagaacctccagcttcag
gctgttcaaaactctggtcccatcatcattcggacaccaaccgtggggcccaatggacag
gtcagttggcagacccttcagctgcagaatcttcaagttcagaacccacaagcccagaca
atcaccttggcccctatgcagggtgtttccttggggcagactagcagcagtaataccacc
ctaacacccattgcctcagctgcctccattcctgctggcacagtcactgtgaatgctgct
caactctcctccatgccaggcctccagaccattaacctcagtgcattgggtacttcaggg
atccaggtgcaccagcttccaggcctgcctttggctatagcaaacaccccaggtgatcat
ggaactcaacttggtcttcatggatctggtggtgatgggatacatgatgagacagcaggt
ggagaaggagagaatagctctgatctccaaccccaagctggacgcaggactcgtcgggaa
gcatgtacatgcccctattgcaaagacagtgagggaagagcctcaggagatcctggcaaa
aagaaacagcacatttgtcacatccaaggatgcggcaaagtatatggcaagacctcacat
ctccgagcacacttgcgctggcatacaggggagaggccattcatgtgtaattggtcatat
tgtgggaagcgctttacacgttcggacgagcttcagagacataaacgtacacatacagga
gagaagaaatttgcctgccctgagtgccctaagcgtttcatgaggagtgatcacctgtca
aagcatatcaagactcaccagaacaagaagggaggcccaggtgtagccctgagtgtgggc
acattgcccctggacagtggggcaggttcagaaggcactgccactccttcagcccttatt
accaccaatatggtagccatggaggccatctgtccagagggtattgcccgtcttgccaac
agtggcatcaacgtcatgcaggtgacagagctgcagtccattaatatcagtggcaatggt
ttctaa

DBGET integrated database retrieval system