KEGG   Mus musculus (mouse): 208043Help
Entry
208043            CDS       T01002                                 

Gene name
Setd1b, AA516740, BC035291, KMT2G, mKIAA1076
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    208043 (Setd1b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     208043 (Setd1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     208043 (Setd1b)
   HMT complexes
    COMPASS/SET1 complex
     208043 (Setd1b)
    COMPASS/SET1 complex (yeast)
     208043 (Setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 208043
NCBI-ProteinID: NP_001035488
MGI: 2652820
Ensembl: ENSMUSG00000038384
Vega: OTTMUSG00000017166
UniProt: Q8CFT2 Q3URP1
LinkDB All DBs
Position
5; 5 F
AA seq 1985 aa AA seqDB search
MENSHPHHHHQQPPPQPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSS
NRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNVRENFLRD
MCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKEAVQHLHSTSVMGNIIHVELDTK
GETRMRFYELLVTGRYTPQTLPVGELDAISPIVSETLQLSDALKRLKDGSLSAGCGSGSS
SVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPITPRLGTPFSQDSSYSSRQPTPSYLFS
QDPTATFKARRHESKFTDAYNRRHEHHYVHNSAVAGATAPFRGSSDLSFGTVGSSGTPFK
AQSQDATTFAHTPPPAQTATASGFKSAFSPYQTPAPPFPPPPEEPTATAAFGSRDSGEFR
RAPAPPPLPPAEPPAKEKPGTPPGPPPPDSNSMELGGRPTFGWSPEPCDSPGTPTLESSP
AGPEKPHDSLDSRIEMLLKEQRTKLPFLREQDSDTEIQMEGSPISSSSSQLSPLSHFGTN
SQPGFRGPSPPSSRPSSTGLEDISPTPLPDSDEDEDLGLGLGPRPPPEPGPPDPMGLLGQ
TAEVDLDLAGDRTPTSERMDEGQQSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGAV
AAPNVLAPNLPLPPPPGFPPLPPPPPPPPPQPGFPMPPPLPPPPPPPPPAHPAVTVPPPP
LPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQMLSRLMTGQ
GACPYPPFMAAAAAAASAGLQFVNLPPYRSPFSLSNSGPGRGQHWPPLPKFDPSVPPPGY
IPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLT
PVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEP
PDTASSGDQKRLRPSTSVDEEDEESERERDRDIADAPCELTKRDPKSVGVRRRPGRPLEL
DSGGEEDEKESLSASSSSSASSSSGSSTTSPSSSASDKEEEDRESTEEEEEEEEEEAEEE
EEEGPRSRISSPSSSSSSDKDDEDDNEADSDGQIDSDIDDQGAPLSEASEKDNGDSEEEE
TESITTSKAPAESSSSSSESSGSSEFESSSESESSSSSSEDEEEMTVPGVEEEEEEEEEE
EKETAMAAATVVAMAEESMPPAGGQDFEQDRAEVPLGPRGPMRESLGTEEEVDIEAEDEV
PEMQAPELEEPPLPMGARKLEGSPEPPEEPGPNTQGDMLLSPELPARETEEAQLPSPPEH
GPESDLDMEPEPPPMLSLPLQPPLPPPRLLRPPSPPPEPETPEPPKPPVPLEPPPEDHPP
RTPGLCGSLAKSQSTETVPATPGGEPPLSGSSSGLSLSSPQVPGSPFSYPSPSPGLSSGG
LPRTPGRDFSFTPTFPEPSGPLLLPVCPLPTGRRDERTGPLASPVLLETGLPLPLPLPLP
LPLALPVPVLRAQPRPPPQLPPLLPATLAPCPTPIKRKPGRPRRSPPSMLSLDGPLVRPP
PGPALGRDLLLLPGQPPAPIFPSAHDPRAVTLDFRNTGIPAPPPPLPPQPPPPPPPPPVE
STKLPFKELDNQWPSEAIPPGPRRDEVTEEYVDLAKVRGPWRRPPKKRHEDLVAPSASPE
PSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVY
HPSTSLSSAKKKKREDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGM
SIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGL
FAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFA
RFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENC
RGTLN
NT seq 5958 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcacccccaccaccaccaccagcagcccccgccgcagcccggcccttcg
ggcgagaggaggaaccaccattggagaagttacaagttgatgattgacccggctctgaaa
aaggggcaccataaactgtaccgctacgatgggcagcatttcagcctggccatgtccagc
aaccgcccggtggagatcgtggaagatccccgggtggtcggaatctggaccaaaaacaag
gagctggagctgtctgtgcccaaattcaagatcgatgagttctacgtgggccctgtgcct
ccaaagcaggtgacatttgccaagctgaatgacaacgtccgtgaaaacttcctaagggac
atgtgcaaaaagtatggggaggtggaggaggtggagatcttgtataacccgaagaccaag
aaacacctgggcattgccaaggtggtctttgccacagtcaggggcgccaaggaggccgtc
caacacctgcacagcacttctgtcatgggcaacattatccacgtggagctggacaccaaa
ggggaaactcgcatgcgcttctacgagctgttggtcaccggccggtacacccctcagacc
ctccctgttggtgagctggatgctatttctccgattgtgagcgagaccctgcagctatca
gatgctctgaagcgcctcaaagatggcagcctgtctgcaggctgcggctctggctcctcg
tcagtcacccccaatagcggtgggacccccttctcccaagacacagcttactccagctgc
cgcctggacacacccaactcctatggacaaggcaccccaatcacgcctcgcctgggcacc
cctttctcccaggattccagctactccagccgtcagcccacaccctcctatctcttcagc
caggaccccacagccacattcaaggcgaggcggcacgagagcaagttcacagatgcctac
aaccgccgccacgaacatcattatgtccacaactcagcggtggctggagccacagctcct
ttccgaggctcctcggacctctcttttgggacagttggcagcagcgggactcccttcaag
gctcagtcgcaggatgccaccacgtttgcccatactccacctcctgcccaaacagccacg
gcttctggattcaaatcagctttctctccatatcagactccagcaccccccttcccgcca
ccccctgaggagcccaccgccacagcagcctttgggagccgcgacagtggggagttccgg
agggcacctgcgcccccgcccctgccacccgctgagcctccagccaaggagaagccaggc
acccctcctggtcccccgccccctgacagcaacagcatggagctgggtggtcggcctacc
tttggctggagtcctgagccctgtgacagccctggcacccctactctggagtcctctcca
gccgggccagagaagccccatgacagcctggactcccgcattgagatgctgctgaaggag
caacgcaccaagctgcccttccttcgtgagcaggactcagacaccgagatacagatggaa
ggcagccccatctcctcctcctcctcccaactctccccgctcagccactttggcactaac
tcgcagcccggcttccgcggtccctcgccaccctcctcgcgcccctccagcacaggtcta
gaggacatcagtcccacaccactgcctgactctgatgaagatgaggacttgggcctgggc
ctggggcctcggcccccacctgagccaggccccccagaccctatgggtctgctaggccag
acagccgaggtggatttggacctggcaggagacaggacccccacctcagagcggatggat
gagggccagcagtcctcaggagaggacatggaaatctcagatgatgagatgccctcggcc
cccatcaccagcgctgactgccccaagcccatggtggtgaccccaggggccggggctgtg
gcagcccccaacgtgctggctccaaacctgcccctgcccccaccccctggcttccctcca
ttacccccgccccctcctccacccccaccacaacctggcttccccatgcccccacctctg
cctccaccaccaccaccaccaccaccagcccatcctgcagtgacagtgcccccgccaccc
ttgccagcgcccccgggtgtcccgcccccacccatccttccgccgctacctcccttccca
ccgggactgtttcctgtgatgcaggtggacatgagccatgtgctgggtggccagtggggt
ggcatgcccatgtccttccagatgcaaacacagatgttaagccggctcatgacaggccag
ggggcttgtccctacccacctttcatggccgctgcggctgccgccgcttctgctggactg
cagtttgtcaacttgcccccctaccggagcccattctccctgagcaacagtggcccagga
cgtggacagcattggccgcccctgcccaagtttgacccctccgtgccaccaccaggctac
ataccacgtcaggaggacccgcacaaggccacggtggatggggtcttgctggtagtgctc
aaggaacttaaggccatcatgaagcgtgatctcaaccgcaagatggtagaggtggtggcc
ttccgggcctttgacgaatggtgggacaagaaggagcggatggccaaggcctcactgacc
cccgtgaagtccggtgagcacaaggacgaggacaggccaaagcccaaagaccgaatcgcc
tcctgtctgctggagtcgtggggcaagggtgagggcctgggttacgagggcctaggcctg
ggcattggactgcggggcgccattcgcttgccctccttcaaggtcaagaggaaggagcca
ccggacacagcctcttctggtgaccagaagcggctacggccttcaacctctgtggatgag
gaagatgaagagtcagagcgggagcgggaccgggacatagctgatgctccctgcgaactc
accaagcgggaccccaaaagcgtgggtgtgcgacgccggccaggacggcccctggagctg
gacagcggcggggaggaggatgagaaggagtccttgtcagcgtcctcctcttcctcagca
tcctcatcctctggatcttctaccacctcaccctcatcctccgcctcagacaaggaagag
gaggaccgagaaagcaccgaggaggaggaggaggaagaggaggaggaagcagaggaagag
gaggaggaaggccccaggagccgcatatcctcaccctcatcctcctcaagctccgacaag
gatgacgaagatgacaacgaagccgacagcgatggccagattgattcagacatcgacgat
cagggtgcacccctgtcggaggccagcgagaaagacaatggagattctgaggaggaggag
acagagagcatcaccacctcaaaggccccagctgagtcgtcctcatcctccagtgaaagt
tctggatcttctgagtttgaatccagttccgagtccgagtcttcatcttcatcctcagag
gacgaggaggagatgaccgtacctggggtggaggaagaagaggaggaggaggaagaggag
gagaaagagactgcaatggctgcagccacggtagtggctatggcagaagagagcatgcct
ccagcgggtggccaggactttgagcaggacagggcagaagtgcctctgggcccacgaggc
cccatgagggagtccttgggcacagaggaggaagtggacattgaggctgaggacgaagtc
cctgagatgcaggctcctgagctggaggagcctccattgcccatgggtgctcggaagctg
gaagggagcccagagcccccagaagagccaggccccaacacacaaggggacatgctgctc
tctccagagctccctgcccgggagacggaggaggctcaactcccatcaccgcctgaacat
ggtccagagtcagacctggacatggagcccgagccccctcctatgctctccttgcccttg
cagccgccattgccgccccctcgactgctccggccacccagcccaccgcctgagcctgag
accccagagccccccaaacctcccgtccccctggagcctcccccagaagaccaccctcca
cgtaccccaggcctctgtggcagtctggccaagtcacagagcacagagacagtgccagcc
accccaggcggggagcccccactgtcagggagcagcagtggcctgtccctgagctccccg
caggtgcctggcagcccgttctcctatccatccccgtcccccggcttgagcagtggggga
cttccacggacacctggtcgggacttcagcttcacacctactttccctgagcccagtgga
cccttgcttctgcctgtctgtcccctcccaaccggtcggcgagatgagcgtaccggcccc
ctggcctccccagtgctcctggaaactggcctgcccctcccacttcccctgcccctgccc
ttacctctggcattgcctgtcccggttctgagggcccagcctcggccacctccccagctg
cctcccctactgcccgctaccctagctccctgcccaacccccatcaagaggaagccaggc
cggccccggagatccccaccgtccatgctgtccttggatgggcctttggtccggccaccg
ccaggacctgcccttgggagggaccttctcctcctgccaggccagccaccggcccccatt
ttccccagcgcacatgaccctcgggctgtgaccttggacttccggaacacggggatcccg
gcccccccaccgcccctcccaccccagcctcccccacctccacccccaccacccgttgaa
tccaccaagctacccttcaaggagctggacaaccagtggccctctgaagctatcccccca
ggacctcgccgagatgaggtcactgaagagtacgtggacctggccaaggtgcggggaccg
tggcggcggccacccaagaagcggcacgaagacctggtggccccatcggcctcacctgaa
ccctcaccaccccagcctctcttccggccccgctcagagtttgaggagatgaccatcttg
tacgacatctggaacggtggcatcgacgaggaggacatccgcttcctgtgcgtcacctac
gagcgcctgctgcagcaggacaatggcatggactggctgaatgacacactctgggtctac
catccctccaccagcctctcctcagccaagaaaaagaaacgggaggacggtatccgtgag
cacgtgacaggctgcgcccgaagcgagggcttctacaccatcgacaagaaggacaagctg
agatacctcaacagcagccgtgccagcacagacgagccccccatggacacccagggtatg
agtatcccagcccagccccatgcctctactcgggcaggctcagagcggcggtctgagcag
aggcgcctcttgtcctccttcaccggcagctgtgacagcgacctgctcaagttcaaccag
ctcaagtttcgaaagaagaagctcaaattctgtaagagccacattcacgactggggcctg
tttgccatggagccaattgctgctgacgagatggtcatcgagtacgtgggccagaacatc
cgccaggtgattgcggacatgagggagaaacggtatgaggatgaaggcatcggtagcagc
tacatgttcagagtagaccatgacaccatcatcgacgccaccaagtgcggcaactttgca
cgcttcattaaccacagctgcaatcccaactgctacgccaaggtgatcacggtggagtcc
cagaagaagatcgtcatctactctaagcagcacatcaacgtcaacgaggagatcacgtac
gactacaagttcccgatcgaagatgtcaagatcccctgcctctgtggctccgagaactgc
cgggggaccctcaattag

DBGET integrated database retrieval system