KEGG   Mus musculus (mouse): 20846Help
Entry
20846             CDS       T01002                                 

Gene name
Stat1, 2010005J02Rik, AA408197
Definition
(RefSeq) signal transducer and activator of transcription 1
  KO
K11220  signal transducer and activator of transcription 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04917  Prolactin signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05212  Pancreatic cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    20846 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20846 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    20846 (Stat1)
   04621 NOD-like receptor signaling pathway
    20846 (Stat1)
   04625 C-type lectin receptor signaling pathway
    20846 (Stat1)
   04658 Th1 and Th2 cell differentiation
    20846 (Stat1)
   04659 Th17 cell differentiation
    20846 (Stat1)
   04062 Chemokine signaling pathway
    20846 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    20846 (Stat1)
   04919 Thyroid hormone signaling pathway
    20846 (Stat1)
  09158 Development
   04380 Osteoclast differentiation
    20846 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20846 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    20846 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    20846 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    20846 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20846 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    20846 (Stat1)
  09172 Infectious disease: viral
   05162 Measles
    20846 (Stat1)
   05164 Influenza A
    20846 (Stat1)
   05161 Hepatitis B
    20846 (Stat1)
   05160 Hepatitis C
    20846 (Stat1)
   05168 Herpes simplex virus 1 infection
    20846 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    20846 (Stat1)
   05169 Epstein-Barr virus infection
    20846 (Stat1)
   05165 Human papillomavirus infection
    20846 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    20846 (Stat1)
   05140 Leishmaniasis
    20846 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20846 (Stat1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    20846 (Stat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1 BORCS7 NPV_P10 DUF3523
Motif
Other DBs
NCBI-GeneID: 20846
NCBI-ProteinID: NP_001192242
MGI: 103063
Ensembl: ENSMUSG00000026104
Vega: OTTMUSG00000046734
UniProt: Q8CFQ1 Q8C8M3 A0A087WSP5
LinkDB All DBs
Position
1 C1.1; 1 26.81 cM
AA seq 755 aa AA seqDB search
MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIIYNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTLEELQDEYDFKCKTSQNR
EGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNSIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLEELEQKFTYEPDPITKNKQV
LSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLEVFVPFQTTSLPVVVISNVSQLPSGWASILWY
NMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPD
GLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQ
QPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVM
AAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHP
SRLQTTDNLLPMSPEEFDEMSRIVGPEFDSMMSTV
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtggttcgagcttcagcagctggactccaagttcctggagcaggtccaccag
ctgtacgatgacagtttccccatggaaatcagacagtacctggcccagtggctggaaaag
caagactgggagcacgctgcctatgatgtctcgtttgcgaccatccgcttccatgacctc
ctctcacagctggacgaccagtacagccgcttttctctggagaataatttcttgttgcag
cacaacatacggaaaagcaagcgtaatctccaggataacttccaagaagatcccgtacag
atgtccatgatcatctacaactgtctgaaggaagaaaggaagattttggaaaatgcccaa
agatttaatcaggcccaggagggaaatattcagaacactgtgatgttagataaacagaag
gagctggacagtaaagtcagaaatgtgaaggatcaagtcatgtgcatagagcaggaaatc
aagaccctagaagaattacaagatgaatatgactttaaatgcaaaacctctcagaacaga
gaaggtgaagccaatggtgtggcgaagagcgaccaaaaacaggaacagctgctgctccac
aagatgtttttaatgcttgacaataagagaaaggagataattcacaaaatcagagagttg
ctgaattccatcgagctcactcagaacactctgattaatgacgagctcgtggagtggaag
cgaaggcagcagagcgcctgcatcgggggaccgcccaacgcctgcctggatcagctgcaa
agctggttcaccattgttgcagagaccctgcagcagatccgtcagcagcttaaaaagctg
gaggagttggaacagaaattcacctatgagcccgaccctattacaaaaaacaagcaggtg
ttgtcagatcgaaccttcctcctcttccagcagctcattcagagctccttcgtggtagaa
cgacagccgtgcatgcccactcacccgcagaggcccctggtcttgaagactggggtacag
ttcactgtcaagctgagactgttggtgaaattgcaagagctgaactataacttgaaagtg
aaagtctcatttgacaaagatgtgaacgagaaaaacacagttaaaggatttcggaagttc
aacatcttgggtacgcacacaaaagtgatgaacatggaagaatccaccaacggaagtctg
gcagctgagttccgacacctgcaactgaaggaacagaaaaacgctgggaacagaactaat
gaggggcctctcattgtcaccgaagaacttcactctcttagctttgaaacccagttgtgc
cagccaggcttggtgattgacctggaggtctttgttccctttcagaccacctctcttcct
gtcgtggtgatctccaacgtcagccagctccccagtggctgggcgtctatcctgtggtac
aacatgctggtgacagagcccaggaatctctccttcttcctgaaccccccgtgcgcgtgg
tggtcccagctctcagaggtgttgagttggcagttttcatcagtcaccaagagaggtctg
aacgcagaccagctgagcatgctgggagagaagctgctgggccctaatgctggccctgat
ggtcttattccatggacaaggttttgtaaggaaaatattaatgataaaaatttctccttc
tggccttggattgacaccatcctagagctcattaagaagcacctgctgtgcctctggaat
gatgggtgcattatgggcttcatcagcaaggagcgagaacgcgctctgctcaaggaccag
cagccagggacgttcctgcttagattcagtgagagctcccgggaaggggccatcacattc
acatgggtggaacggtcccagaacggaggtgaacctgacttccatgccgtggagccctac
acgaaaaaagaactttcagctgttactttcccagatattattcgcaactacaaagtcatg
gctgccgagaacataccagagaatcccctgaagtatctgtaccccaatattgacaaagac
cacgcctttgggaagtattattccagaccaaaggaagcaccagaaccgatggagcttgac
gaccctaagcgaactggatacatcaagactgagttgatttctgtgtctgaagtccaccct
tctagacttcagaccacagacaacctgcttcccatgtctccagaggagtttgatgagatg
tcccggatagtgggccccgaatttgacagtatgatgagcacagtataa

DBGET integrated database retrieval system