KEGG   Mus musculus (mouse): 20847Help
Entry
20847             CDS       T01002                                 

Gene name
Stat2, 1600010G07Rik, AW496480
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04062  Chemokine signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    20847 (Stat2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20847 (Stat2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    20847 (Stat2)
   04625 C-type lectin receptor signaling pathway
    20847 (Stat2)
   04062 Chemokine signaling pathway
    20847 (Stat2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    20847 (Stat2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20847 (Stat2)
  09172 Infectious disease: viral
   05162 Measles
    20847 (Stat2)
   05164 Influenza A
    20847 (Stat2)
   05161 Hepatitis B
    20847 (Stat2)
   05160 Hepatitis C
    20847 (Stat2)
   05168 Herpes simplex virus 1 infection
    20847 (Stat2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    20847 (Stat2)
   05169 Epstein-Barr virus infection
    20847 (Stat2)
   05165 Human papillomavirus infection
    20847 (Stat2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20847 (Stat2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20847 (Stat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT2_C SH2 IRF-2BP1_2
Motif
Other DBs
NCBI-GeneID: 20847
NCBI-ProteinID: NP_064347
MGI: 103039
Ensembl: ENSMUSG00000040033
UniProt: Q9QXJ2
LinkDB All DBs
Structure
PDB: 

Position
10 D3; 10 76.5 cM
AA seq 922 aa AA seqDB search
MAQWEMLQNLDSLFLDQLHQVYSQSILPMDVRQHLATWIEDQNWREAALGSDDAKANMLY
FSILDQLNQWDHYSSDSNHFLLQHNLRKFSRDIQTFPNGPTQLAEMIFNLLLEEQRILNQ
AQRAQEVQPPPAPEAVVESQQLEIENRIQGLHVDIEFLVRSIRQLKDEQDVFSFRYTVFS
LKKTSSSDPHQSQQAQLVQATANKVDRMRKEVLDISKGLVGRLTTLVDLLLPKLDEWKVQ
QQKSCIGAPPPELQLEQLEQWLTAGAKFLFHLRQLLKQLKEMSHMLRYKGDMFGQGVDLQ
NAQVMELLQRLLQRSFVVETQPCMPQTLHRPLILKTGNKFTVRTRLLVRLQEGSESLKAE
VSVDRNSDLPGFRKFNILTSNQKTLTPEEGQRQGLIWDFGFLTLVEQRAVGAGKGNKGPL
AVTEELHVISFVVEYVYQGLKMKLQTDTLPVVIISNMNQLSIAWASILWFNMLSPNPKNQ
QFFCQAPKAPWSLLGPVLSWQFSSYVGRGLDSEQLGMLRTKLFGKSCKMEDALLSWVDFC
KRESPPGKIPFWTWLDKILELVHDHLKDLWKDGRIMGFVSRNQERRLLKKMLSGTFLLRF
SETSEGGITCSWVEHQDDDKVEIYSVQPYTKEVLQSLPLTEIIRHYQVLAEENIPENPLR
FLYPRIPRDEAFGCYYQEKVNFEEQRKYLKHKLIVISNRQVDELQQPLELKQDSESLEVN
AELLLAHDQELPLMMQTGLVLGTELKVDPILSTAPQVLLEPAPQVLLEPAPQVPLEPAPQ
VLLEPAPQVLLEPAPQVLLEPAPQVLLEPAPQVQLEPAPQVLLELAPQVLLEPAPQVLLE
LAPQVQLEPAHLLQQPSESDLPEDLQQISVEDLKKLSNPSTEYITTNENPMLAGESSGDE
TSIPYHSHFDADGLLGWTLDTF
NT seq 2769 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggagatgttgcagaaccttgacagcctgttcctggaccagttacaccag
gtctactcacagagcatcctgccaatggacgttcgacagcatttggctacctggattgaa
gaccagaactggagggaagctgcgctgggcagtgatgacgccaaggccaacatgctatac
ttcagcatcctggaccaactgaaccagtgggaccactacagctcagactccaatcacttt
ttattacagcataacttgcgaaaattcagccgggatattcagacctttcccaatggccct
acccagttggctgagatgatctttaatcttcttctggaagagcaaaggattctgaatcag
gctcaaagagctcaagaggtgcagcccccaccagcccccgaagcagttgtggagagccag
cagcttgagattgaaaatcgaatccagggtttacatgtggacattgagttcttggtgaga
tccatcaggcagctgaaggacgaacaggatgtcttcagcttcagatacacagttttcagt
ctgaagaagacgtcgtcttcagacccccatcagagccaacaggcgcagcttgtgcaggca
acagccaacaaagtcgacagaatgagaaaggaggtgctggacatctccaaaggactggtt
ggccgattaaccaccctggtcgacctattgctgcccaagctggacgagtggaaggtgcag
cagcagaagtcctgcattggagccccgccccccgagctgcagctggaacagctggaacag
tggttgacggctggagcaaagttcttgttccaccttcggcagctactgaagcagctgaag
gagatgagtcacatgcttcggtataagggtgacatgtttggccaaggggtggacctgcag
aatgcccaagtcatggagttacttcagcgtctgctccaaaggtcctttgtagtagaaacc
cagccctgcatgccccagactctccaccgacccctcatcctgaagactgggaacaagttc
accgtccgaacaagacttctggtgagactccaggaaggcagcgaatcactcaaagcagaa
gtctctgtcgacaggaattcagacttaccaggcttccggaagttcaacattctgacctca
aaccaaaaaaccttgaccccggaggagggccagagacagggcttaatttgggacttcggc
ttcttgactctggtggagcaacgcgctgtgggtgcaggaaagggcaacaaggggccgctg
gcagtgacagaggagttacatgtcatcagcttcgtggttgagtacgtgtaccagggtctg
aagatgaagctgcagacggacactctccctgttgtgattatttctaacatgaaccaactc
tccattgcctgggcctccattctctggttcaacatgctcagcccaaatcccaagaaccag
cagttcttctgccaagctccgaaagccccctggagtttgctgggacctgtgctcagctgg
cagttctcctcttacgttggccgaggcctcgattctgagcagctgggcatgctgagaacc
aagctgtttggaaagagctgcaagatggaggatgcgctgttgtcctgggtagacttttgc
aagcgagagagcccccctggtaagatccctttctggacctggctggacaaaattctggag
ctggtgcacgaccacctgaaggatctctggaaggatgggcgcatcatgggctttgtgagc
cgcaaccaggaacgcagactgctgaagaagatgttgtctggcaccttcctactgcgcttc
agtgaaacttctgaagggggcattacttgttcttgggtggagcaccaggatgacgataaa
gtcgaaatctactcagtgcagccctacaccaaggaagtgttacagtcactcccactgaca
gagatcatccgccactaccaggttcttgccgaagagaacatccccgagaacccactccgc
ttcctctatccccgaatccctcgggacgaagcttttgggtgttactaccaggaaaaagtt
aattttgaagaacagaggaaatatttgaaacataaactcattgtgatctctaacagacag
gtggacgagctgcagcagcctctggagctcaaacaggattcagagtccttagaagtgaat
gcagagctcttgttagcacacgaccaggagttgccattgatgatgcagactgggctggtt
ctgggcacagagctgaaagtggaccccatactgagtacagccccacaagtcctgctggag
ccagccccacaagtcctgctggagccagccccacaagtcccgctggagccagccccacaa
gtcctgctggagccagccccacaagtcctgctggagccagccccacaagtcctgctggag
ccagccccacaagtcctgctggagccagccccacaagtccagctggagccagccccacaa
gtcctgctggagctagccccacaagtcctgctggagccagccccacaagtcctgctggag
ctagccccacaagtccagctggagccagcacacttgctgcagcagccatcagagtcagat
ttgcctgaggacctgcagcagattagcgtggaggatctgaaaaaattaagcaacccgagt
actgaatacatcacaaccaacgaaaacccaatgttggctggcgagagcagtggagatgag
acttccataccctaccacagccattttgatgcggatggactcttgggatggactcttgat
accttctga

KEGG   Mus musculus (mouse): 20849Help
Entry
20849             CDS       T01002                                 

Gene name
Stat4
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    20849 (Stat4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20849 (Stat4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    20849 (Stat4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20849 (Stat4)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    20849 (Stat4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    20849 (Stat4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20849 (Stat4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20849 (Stat4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 NPV_P10 Prp19 CRC_subunit
Motif
Other DBs
NCBI-GeneID: 20849
NCBI-ProteinID: NP_001295195
MGI: 103062
Ensembl: ENSMUSG00000062939
Vega: OTTMUSG00000046732
UniProt: P42228 Q3V157
LinkDB All DBs
Structure
PDB: 

Position
1 C1.1; 1 26.67 cM
AA seq 748 aa AA seqDB search
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEVASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPIQGPLEKSLQSSSVSERQRNVEHKVSAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQGDKNSILVNQEVLTLQEMLNSLDFKRKEALSKMTQIVNETDLLMNSMLLEELQDWKK
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEKLQEQSTKMTYEGDPIPAQRAHL
LERATFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTHVKAMSSEESSNGSLSVEFRHLQPKEMKCSTGSKGNEGCH
MVTEELHSITFETQICLYGLTINLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSEQLNMLAEKLTVQSNYNDGHLTWAKFCK
EHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPQSPSDLLPM
SPSAYAVLRENLSPTTIETAMNSPYSAE
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacaattagaaatcaagtttttggagcaagtagatcag
ttctatgatgacaactttcctatggaaatccggcatctgctagctcagtggattgagact
caagactgggaagtagcttctaacaatgaaactatggcaacaattctgcttcaaaactta
ctaatacaattggatgaacagttggggcgtgtttccaaagaaaaaaatctgctattgatt
cacaatctaaagagaattagaaaagttcttcagggcaagtttcatggaaatccaatgcat
gtagctgtggtaatttcaaattgcttaagggaagagaggagaatattggctgcagccaac
atgcctatccagggacctctggagaaatccttacagagttcttcagtttctgaaagacaa
aggaatgtggaacacaaagtgtctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagacctgcaagatgagtttgactacaggtataaaacaattcagaca
atggatcagggtgacaaaaacagtatcctggtgaaccaggaagttttgacgctgcaagaa
atgcttaatagtctggacttcaagagaaaggaagcactcagtaagatgacgcagatagtg
aacgagacagacctgctcatgaacagcatgcttctagaagagctgcaggactggaaaaag
cggcagcagattgcctgcattggtggcccgctccacaatgggctggaccagcttcagaac
tgctttaccctactggcagagagtcttttccaactcagacagcaactggagaaactacag
gagcaatctactaaaatgacctatgaaggggatcccatccctgctcaaagagcacacctc
ctggaaagagctaccttcctgatctacaaccttttcaagaactcatttgtggtcgagcga
cagccatgcatgccaacgcaccctcagaggccgatggtacttaaaaccctcattcagttc
actgtaaaactgagattactaataaaattgccggaactaaactatcaggtgaaagtaaag
gcgtccattgacaagaatgtttcaactctaagcaatagaagatttgtgctttgtggaact
cacgtcaaagctatgtccagtgaggaatcttccaatgggagcctctcagtggagtttaga
catttgcaacccaaggagatgaagtgcagtactgggagtaaaggaaacgagggctgccac
atggtgacagaggagttgcattccataacctttgagacccagatctgcctctatggcctc
accattaacctagagaccagctcattacctgtcgtgatgatttctaatgtcagccaacta
cctaatgcatgggcatccatcatttggtacaatgtatcaactaacgactcccagaacttg
gttttctttaataaccctccatctgtcactttgggccaactcctggaagtgatgagctgg
caattttcatcctatgtcggtcgtggccttaattcagagcagctcaacatgctggcagag
aagctcacagttcagtctaactacaatgatggtcacctcacctgggccaagttctgcaag
gaacatttgcctggcaaaacatttaccttctggacttggcttgaagcaatattggaccta
attaaaaaacatattcttcccctctggattgatgggtacatcatgggatttgttagtaaa
gagaaggaacggcttctgctcaaagataaaatgcctgggacatttttgttaagattcagt
gagagccatcttggagggataaccttcacctgggtggaccaatctgaaaatggagaagtg
agattccactctgtagaaccctacaacaaagggagactgtcggctctgccgttcgctgac
atcctgcgagactacaaggttatcatggctgaaaacatccctgaaaaccctctgaagtac
ctctaccctgacattcccaaagacaaagcctttggcaaacactacagctcccagccgtgc
gaagtctcaagaccaaccgaacggggagacaagggttacgtcccctctgtttttatcccc
atttcaacaatccgaagcgattccacggagccacaatctccttcagaccttctccccatg
tctccaagtgcatatgctgtgctgagagaaaacctgagcccaacgacaattgaaactgca
atgaattccccatattctgctgaatga

KEGG   Mus musculus (mouse): 20852Help
Entry
20852             CDS       T01002                                 

Gene name
Stat6
Definition
(RefSeq) signal transducer and activator of transcription 6
  KO
K11225  signal transducer and activator of transcription 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    20852 (Stat6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20852 (Stat6)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    20852 (Stat6)
   04659 Th17 cell differentiation
    20852 (Stat6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20852 (Stat6)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    20852 (Stat6)
  09172 Infectious disease: viral
   05161 Hepatitis B
    20852 (Stat6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20852 (Stat6)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20852 (Stat6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT6_C STAT_bind STAT_int STAT_alpha SH2
Motif
Other DBs
NCBI-GeneID: 20852
NCBI-ProteinID: NP_033310
MGI: 103034
Ensembl: ENSMUSG00000002147
Vega: OTTMUSG00000031818
UniProt: P52633
LinkDB All DBs
Position
10 D3; 10 74.59 cM
AA seq 837 aa AA seqDB search
MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgtggggcctaatttccaagatgtccccagaaaaactgcaacggctctatgtt
gactttccacaacgcctacggcatctcctggctgactggctggagagccagccctgggag
ttcctggtcggttcagatgctttctgttacaacatggccagtgccctactttctgccaca
gtccagcgtcttcaggccactgctggagagcaggggaagggaaacagcatcttgccgcac
atcagcaccttggagagcatctatcagagggaccccctgaagctggtggccaccatcaga
caaatacttcaaggggagaaaaaagctgttatagaagagttccgccacctgccagggccc
ttccatcggaagcaggaagaactcaagtttactacagccctcggaaggcttcagcatcga
gtaagggagacccggcttctccgagaatctctgcagcaaggggctaagactggacaagtg
tctctgcagaatttgatagaccctcctgtcaatggtcctggtccaagtgaggacctggcc
accatgctgcaggggactgtgggggacctggaggccacccaggccctggtgctgaaaagg
attcagatttggaagcggcagcaacagctggcagggaatggcacaccctttgaggagagc
ctagcagggctgcaggagaggtgtgaaagcctggtggaaatttattcccagctgcagcag
gagattggggcagccagtggagaactggaacccaagacccgggcatcgctgataagccgt
ctggatgaagtcctgcgaacccttgtgaccagctctttcctggtggagaagcagcccccg
caggttctgaagacacagactaagttccaggctggggttcgattcctgctgggtctgcag
tttctagggacctcagccaagcctccaatggtcagagctgacatggtgacagagaaacag
gccagagaactaagcctggcccaggggcccgggactggagtggagagcacaggagagatc
atgaacaacacggtgcccctggagaacagcattcccagcaactgctgctccgccctgttc
aagaacctgctcctgaagaaaataaagcgctgtgagcggaagggcacagagtctgtcacc
gaggagaagtgtgctgtgctcttctccacgagcttcacattgggccccaacaaacttctc
atccagcttcaggccctgtctctgcccttggtggtcatcgtgcatggtaaccaagacaac
aacgccaaagctaccatcctatgggacaatgccttctctgagatggaccgagtgcccttt
gtggtggctgagcgagtgccctgggagaagatgtgtgaaaccctaaacctcaagtttatg
gctgaggtggggaccagccggggactgcttccagagcacttcctgttcctcgcccagaag
atcttcaacgacaacagcctcagtgtggaggcctttcagcaccgctgtgtgtcctggtca
cagttcaataaggagatcctgctgggccgaggcttcacattttggcagtggtttgatggt
gtcctggacctcaccaaacgctgtctccggagctactggtcagatcggctgatcattggc
tttattagtaagcaatatgtcactagccttctcctcaatgagccagatgggaccttcctc
ctccgctttagcgactctgagatcgggggcatcaccattgcacacgtcatccggggtcag
gatggctcctcacagatagagaacatccagccattttctgccaaagacctgtccattcgc
tcactgggggaccggatccgggatcttgctcagttaaaaaacctctaccccaagaaaccc
aaagatgaggctttccggagtcactataagcccgaacagatggggaaggacgggaggggt
tatgtctctactactatcaagatgactgtggaaagggaccagccccttcctactccagag
ccccagatgcctgccatggtgccaccttatgatcttggaatggcccctgatgcttccatg
caactcagctcagatatggggtatcctccacagtccatccactcatttcagagcctagaa
gagtccatgagtgtactgccatcttttcaggagcctcacctgcaaatgccccccaacatg
agccagataaccatgccctttgaccagcctcacccccagggtctgctgcagtgccagtcc
caggaacatgctgtgtccagccctgaacccatgctttgctcagatgtgactatggtagag
gacagctgcctaactcagcctgtgggaggtttcccccaaggcacctgggtcagtgaagac
atgtaccctcccctgatgcctcccactgaacaggacctcaccaagcttctcctggagaac
caaggggaggcaggagggtccttaggaagccagcccctcctgcaaccatctccttatggg
caatcagggatctcactgtcccacctggacctaaggaccaaccccagctggtga

DBGET integrated database retrieval system