KEGG   Mus musculus (mouse): 20850Help
Entry
20850             CDS       T01002                                 

Gene name
Stat5a, AA959963, STAT5
Definition
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04217  Necroptosis
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04917  Prolactin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    20850 (Stat5a)
   04630 Jak-STAT signaling pathway
    20850 (Stat5a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20850 (Stat5a)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    20850 (Stat5a)
   04659 Th17 cell differentiation
    20850 (Stat5a)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    20850 (Stat5a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20850 (Stat5a)
   05203 Viral carcinogenesis
    20850 (Stat5a)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    20850 (Stat5a)
   05220 Chronic myeloid leukemia
    20850 (Stat5a)
   05223 Non-small cell lung cancer
    20850 (Stat5a)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20850 (Stat5a)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    20850 (Stat5a)
   05162 Measles
    20850 (Stat5a)
   05161 Hepatitis B
    20850 (Stat5a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20850 (Stat5a)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20850 (Stat5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 Flu_B_NS1
Motif
Other DBs
NCBI-GeneID: 20850
NCBI-ProteinID: NP_035618
MGI: 103036
Ensembl: ENSMUSG00000004043
Vega: OTTMUSG00000002125
UniProt: P42230 Q9JIA0 Q3UZ79
LinkDB All DBs
Structure
PDB: 

Position
11 D; 11 63.77 cM
AA seq 793 aa AA seqDB search
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRGQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNCSSPAGVLVDAMSQKHLQINQRFEELRLITQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNI
SSNHLEDYNSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFAKYYTPVLAKAVDGYVKPQIKQVVPEFVNASTDAGASATYM
DQAPSPVVCPQPHYNMYPPNPDPVLDQDGEFDLDESMDVARHVEELLRRPMDSLDARLSP
PAGLFTSARSSLS
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagcttcagggagatgccctgcgccagatgcaagtg
ttgtatgggcagcatttccccatcgaggtccggcactacctggcccagtggatcgagagc
cagccgtgggatgctattgacttggataatccccaggaccgaggtcaggccacccaactc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgccacacagctccagaacacgtatgaccgc
tgtcccatggagctggttcgctgtatccgtcacattctgtacaacgaacagaggctggtt
cgcgaagccaacaattgcagctcccctgctggtgtcctggttgacgccatgtcccagaag
caccttcagatcaaccaaaggtttgaggagctgcgcctgatcacacaggacacggagaac
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagcctg
cggatccaagctcagtttgcccagctgggccagctgaacccccaggagcgcatgagcagg
gagacggccctccagcagaagcaagtgtccctggagacctggctgcagcgagaggcacag
acactgcagcagtaccgagtggagctggctgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggacgacgagctgatccagtggaagcggagacagcag
ctggccgggaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacctgtgc
cagcagctgcccatcccaggccccgtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagctctggtcaccagcacgttcatcatcgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcggccaccgtgcgcctgctggtggggggaaagctg
aatgtgcacatgaaccccccgcaggtgaaggcgaccatcatcagcgagcagcaggccaag
tccctgctcaagaatgagaacacccgcaatgagtgcagcggcgagatcctgaacaactgt
tgcgtcatggagtaccaccaggccactggcacgctcagcgcccacttcagaaacatgtca
ctgaaaagaatcaagcgcgccgacaggcgtggtgcagagtcggtgacggaggagaagttc
acagtcctgtttgagtctcagttcagcgttggcagcaacgagctggtgttccaggtgaag
accctgtccctccctgtggtcgttatcgtccatggcagccaggaccacaatgctactgcc
accgtgctgtgggacaatgcctttgctgagccgggcagggtgccatttgctgtgcctgac
aaggtgctgtggccgcagctgtgtgaagcgctcaacatgaaattcaaggctgaagtacag
agcaaccggggcttgaccaaagagaacctcgtgttcctggcacagaaactgttcaacatc
agcagcaaccacctcgaggactacaacagcatgtctgtgtcctggtcccagttcaaccgg
gagaacttgcccggctggaactacaccttctggcagtggttcgacggggtgatggaggtg
ctgaagaagcaccataagccccattggaatgatggggctatcctgggtttcgtgaacaag
caacaggcccacgacctgctcatcaacaagccggacgggaccttcctgctgcgcttcagt
gactcggaaatcgggggcatcaccattgcttggaagtttgactctccggaccgaaacctc
tggaatctgaagccattcacgacgcgagatttctccattcggtccctggccgaccggctg
ggggacctgaactaccttatctacgtgttcccagaccgacccaaggacgaggtctttgcc
aagtattacactcctgtacttgcgaaagcagttgacggatacgtgaagccacagatcaag
caagtggtccctgagttcgtcaatgcatccacagatgccggagccagcgccacctacatg
gaccaggctccttccccagtcgtgtgccctcaacctcactacaacatgtacccacccaac
cctgaccctgtccttgaccaagatggcgagtttgacctggatgagagcatggatgttgcc
aggcacgtggaagaacttttacgccggcccatggacagtctcgacgcccgcctctcccca
cctgctggtctcttcacctccgctagaagctccctgtcctga

KEGG   Mus musculus (mouse): 20851Help
Entry
20851             CDS       T01002                                 

Gene name
Stat5b
Definition
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
mmu04062  Chemokine signaling pathway
mmu04217  Necroptosis
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04917  Prolactin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    20851 (Stat5b)
   04630 Jak-STAT signaling pathway
    20851 (Stat5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    20851 (Stat5b)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    20851 (Stat5b)
   04659 Th17 cell differentiation
    20851 (Stat5b)
   04062 Chemokine signaling pathway
    20851 (Stat5b)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    20851 (Stat5b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20851 (Stat5b)
   05203 Viral carcinogenesis
    20851 (Stat5b)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    20851 (Stat5b)
   05220 Chronic myeloid leukemia
    20851 (Stat5b)
   05223 Non-small cell lung cancer
    20851 (Stat5b)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    20851 (Stat5b)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    20851 (Stat5b)
   05162 Measles
    20851 (Stat5b)
   05161 Hepatitis B
    20851 (Stat5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20851 (Stat5b)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    20851 (Stat5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Motif
Other DBs
NCBI-GeneID: 20851
NCBI-ProteinID: NP_001107035
MGI: 103035
Ensembl: ENSMUSG00000020919
Vega: OTTMUSG00000002127
UniProt: P42232
LinkDB All DBs
Position
11 D; 11 63.63 cM
AA seq 786 aa AA seqDB search
MAMWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQSTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLITQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLGQLNPQERMSRETALQQKQVSLETWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFDSQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNI
SSNHLEDYNSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAADGYVKPQIKQVVPEFANASTDAGS
GATYMDQAPSPVVCPQAHYNMYPPNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atggctatgtggatacaggctcagcagctccagggcgatgcccttcaccagatgcaggcc
ttgtacggccagcatttccccatcgaggtgcgacattatttatcacagtggatcgaaagc
caagcctgggactcaatagatcttgataatccacaggagaacattaaggccacccagctc
ctggagggcctggtgcaggagctgcagaagaaggcggagcaccaggtgggggaagatggg
tttttgctgaagatcaagctggggcactatgccacacagctccagagcacgtacgaccgc
tgccccatggagctggttcgctgtatccggcacattctgtacaacgaacagaggctggtt
cgcgaagccaacaacggcagctctccagctggaagtcttgctgacgccatgtcccagaag
caccttcagatcaaccaaacgtttgaggagctgcgcctgatcacacaggacacggagaac
gagctgaagaagctgcagcagacccaagagtacttcatcatccagtaccaggagagcctg
cggatccaagctcagtttgcccagctgggacagctgaacccccaggagcgcatgagcagg
gagacggccctccagcagaagcaagtgtccctggagacctggctgcagcgagaggcacag
acactgcagcagtaccgagtggagctggctgagaagcaccagaagaccctgcagctgctg
cggaagcagcagaccatcatcctggacgacgagctgatccagtggaagcggagacagcag
ctggccgggaacgggggtccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagctggccgagatcatctggcagaaccggcagcagatccgcagggctgagcacttgtgc
cagcagctgcccatcccaggccccgtggaggagatgctggctgaggtcaacgccaccatc
acggacatcatctcagccctggtcaccagcacgttcatcatcgagaagcagcctcctcag
gtcctgaagacccagaccaagtttgcagccaccgtgcgcctgctggtgggggggaagctg
aatgtgcacatgaaccccccgcaggtgaaggcgaccatcatcagcgagcagcaggccaag
tccctgctcaagaatgagaacacccgcaatgattacagcggcgagatcctgaacaactgt
tgcgtcatggagtaccaccaggccactggcacactcagcgcccacttcagaaacatgtcc
ctgaaacgaatcaagaggtctgaccgccgtggggcagagtcagtaacggaagagaagttc
acgatcctgtttgactcacagttcagcgtcggtggaaacgagctggtctttcaagtcaag
accttgtcgctcccggtggtggtgattgttcacggcagccaggacaacaatgccacagcc
actgtcctctgggacaacgcctttgcagagcctggcagggtgccatttgccgtgcctgac
aaggtgctgtggccgcagctgtgtgaagcgctcaacatgaaattcaaggctgaagtacag
agcaaccggggcttgaccaaggagaacctcgtgttcctggcacagaaactgttcaacatc
agcagcaaccacctcgaggactacaacagcatgtccgtgtcctggtcccagttcaaccgg
gagaatttgccaggacggaattacactttctggcagtggtttgatggcgtgatggaagta
ttgaaaaaacatctcaagcctcactggaatgatggggctatcctgggtttcgtgaacaag
caacaggcccacgacctgctcatcaacaagccagacgggaccttcctgctgcgcttcagc
gactcggaaatcgggggcatcaccattgcttggaagtttgactctcaggagagaatgttt
tggaatctgatgccttttaccactagagacttctctatccggtccctcgctgaccgcctg
ggggacctgaattacctcatatatgtgtttcctgatcggccaaaggatgaagtatattct
aagtactacacaccggtcccctgtgagcccgcaactgcgaaagcagctgacggatacgtg
aagccacagatcaagcaggtggtccccgagtttgcaaatgcatccacagatgctgggagt
ggcgccacctacatggatcaggctccttccccagtcgtgtgccctcaggctcactacaac
atgtacccacccaacccggactccgtccttgataccgatggggacttcgatctggaagac
acgatggacgtggcgcggcgcgtggaagagctcttaggccggcccatggacagtcagtgg
atccctcacgcacagtcatga

DBGET integrated database retrieval system