KEGG   Mus musculus (mouse): 20937Help
Entry
20937             CDS       T01002                                 

Gene name
Suv39h1, AI852103, AL022883, DXHXS7466e, H3-K9-HMTase_1, KMT1A, mIS6
Definition
(RefSeq) suppressor of variegation 3-9 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    20937 (Suv39h1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     20937 (Suv39h1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     20937 (Suv39h1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    20937 (Suv39h1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 20937
NCBI-ProteinID: NP_035644
MGI: 1099440
Ensembl: ENSMUSG00000039231
Vega: OTTMUSG00000017258
UniProt: O54864
LinkDB All DBs
Position
X A1.1; X 3.64 cM
AA seq 412 aa AA seqDB search
MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGVSKKNLYDFEVEYLCDYKKIREQEYY
LVKWRGYPDSENTWEPRQNLKCIRVLKQFHKDLERELVRRHRRSKPPRHLDPNLANYLVQ
KAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRSFVYINEYRVGEGITLNQVAVG
CECQDCLLAPTGGCCPGASLHKFAYNDQGQVRLKAGQPIYECNSRCCCGYDCPNRVVQKG
IRYDLCIFRTNDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQIYDRQGATYLFD
LDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFFATRTIWAGEE
LTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTTACRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggttgcagtgtgtgctgtaaatcttcttggaatcaactgcag
gacctgtgccgactagccaagctttcttgtcctgcccttggtgtttctaagaagaatctg
tatgactttgaagttgaatacctgtgtgattataagaagatccgtgagcaggagtattac
ctggttaagtggcgtgggtatcccgactcagaaaacacctgggagccacggcagaatcta
aaatgtatacgagttcttaagcagttccacaaggacttagaaagagagcttgtccgacga
caccgccggtcaaagccacccaggcatctggacccaaacctagccaattacctggtgcag
aaggccaagcagaggcgggcacttcagcgttgggaacaagagctcaatgccaagcgcagc
cacctggggcggatcaccgtggagaatgaggtagacctggatggccctccaaggtccttt
gtctatatcaatgagtatcgagttggtgagggcatcaccctcaaccaggtagctgttggc
tgtgagtgccaggactgtctgttggcacccactggaggctgttgccctggagcatccctg
cacaagtttgcctacaatgaccaaggccaggtgcgactgaaagctgggcagcccatctac
gagtgcaactcccgctgttgctgtggctatgactgcccaaaccgtgtagtccagaaaggc
atccgctacgatctctgcatcttccgcactaatgatggccgaggctggggtgtccgcacg
ctggaaaagatccgaaaaaatagctttgttatggagtatgtgggagagattattacctca
gaggaggcagagcggaggggccagatctacgaccgccagggcgccacctacctctttgac
ctggactacgtggaagacgtatataccgtggatgccgcttattatggcaacatctctcat
tttgtcaaccatagttgtgatcccaacctgcaggtgtacaacgtattcatagacaacctt
gatgagcgactaccccgcatcgcattctttgccacaagaaccatctgggcgggcgaggag
ctcacctttgattacaacatgcaagtggaccccgtggacatggagagtacccgaatggac
tccaactttggcctggctgggctccccggctcccccaagaaacgagtccgtattgaatgc
aaatgtgggacaacggcttgccgaaaatacctcttctag

DBGET integrated database retrieval system